Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 770213..770699 Replicon chromosome
Accession NZ_OX352996
Organism Streptococcus suis isolate 861160_dhsdS

Toxin (Protein)


Gene name relE Uniprot ID D5AGV2
Locus tag QNH80_RS03715 Protein ID WP_011922754.1
Coordinates 770213..770482 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D5AGV1
Locus tag QNH80_RS03720 Protein ID WP_002938604.1
Coordinates 770472..770699 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNH80_RS03695 766042..767016 - 975 WP_002937257.1 YvcK family protein -
QNH80_RS03700 767013..767900 - 888 WP_074390194.1 RNase adapter RapZ -
QNH80_RS03705 767922..768299 - 378 WP_002937263.1 RidA family protein -
QNH80_RS03710 768483..769807 - 1325 Protein_724 MATE family efflux transporter -
QNH80_RS03715 770213..770482 - 270 WP_011922754.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QNH80_RS03720 770472..770699 - 228 WP_002938604.1 DUF6290 family protein Antitoxin
QNH80_RS03725 770971..772317 - 1347 WP_024405517.1 asparagine--tRNA ligase -
QNH80_RS03730 772332..773513 - 1182 WP_024383693.1 pyridoxal phosphate-dependent aminotransferase -
QNH80_RS03735 773510..774007 - 498 WP_024405519.1 DUF5590 domain-containing protein -
QNH80_RS03740 774309..774758 + 450 WP_024383028.1 MarR family transcriptional regulator -
QNH80_RS03745 774821..775366 + 546 WP_002941732.1 NADPH-dependent FMN reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - neuB 738527..868148 129621


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10437.49 Da        Isoelectric Point: 10.3916

>T296684 WP_011922754.1 NZ_OX352996:c770482-770213 [Streptococcus suis]
MAYKLVLSDDALKQLKKMDRHVGMMLAKDLKKRLDGLENPRQFGKALVGDYKGLWRYRVGNYRVICDIIDNKMVILALEI
GHRKEIYKK

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8450.51 Da        Isoelectric Point: 4.1589

>AT296684 WP_002938604.1 NZ_OX352996:c770699-770472 [Streptococcus suis]
MGIVSLRLNDAEEEIFRSYAIHTGKSLSELFKTALAEQIEDQLDYEIGIKALKKFQENPVTHSIDDVLAELEDGL

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A126UKS2

Antitoxin

Source ID Structure
AlphaFold DB A0A140EXF0

References