Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 1867996..1868602 Replicon chromosome
Accession NZ_OX352944
Organism Streptococcus suis isolate 861160_LM_H

Toxin (Protein)


Gene name parE Uniprot ID A0A0Z8ZB64
Locus tag QNH68_RS08980 Protein ID WP_012775364.1
Coordinates 1867996..1868325 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID D5AKB4
Locus tag QNH68_RS08985 Protein ID WP_012028535.1
Coordinates 1868315..1868602 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNH68_RS08950 1864851..1865324 - 474 WP_024378560.1 IS200/IS605 family transposase -
QNH68_RS08955 1865504..1866376 - 873 WP_024387385.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QNH68_RS08960 1866395..1866925 - 531 WP_074390182.1 DUF1697 domain-containing protein -
QNH68_RS08965 1866939..1867196 - 258 WP_012775363.1 Txe/YoeB family addiction module toxin -
QNH68_RS08970 1867198..1867458 - 261 WP_002939010.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QNH68_RS08975 1867534..1867989 - 456 WP_074390181.1 8-oxo-dGTP diphosphatase -
QNH68_RS08980 1867996..1868325 - 330 WP_012775364.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QNH68_RS08985 1868315..1868602 - 288 WP_012028535.1 hypothetical protein Antitoxin
QNH68_RS08990 1868700..1869068 - 369 WP_012775453.1 hypothetical protein -
QNH68_RS08995 1869061..1869630 - 570 WP_012775700.1 ribonuclease M5 -
QNH68_RS09000 1869614..1870396 - 783 WP_012028536.1 TatD family hydrolase -
QNH68_RS09005 1870503..1870640 - 138 WP_002939016.1 50S ribosomal protein L34 -
QNH68_RS09010 1870808..1871803 - 996 WP_012775367.1 RNA-binding cell elongation regulator Jag/EloR -
QNH68_RS09015 1871823..1872635 - 813 WP_012027897.1 YidC/Oxa1 family membrane protein insertase -
QNH68_RS09020 1872619..1872978 - 360 WP_004194560.1 ribonuclease P protein component -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1843516..1870396 26880
- flank IS/Tn - - 1864851..1865324 473


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-95)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12562.52 Da        Isoelectric Point: 7.1991

>T296682 WP_012775364.1 NZ_OX352944:c1868325-1867996 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK

Download         Length: 330 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10892.43 Da        Isoelectric Point: 4.3464

>AT296682 WP_012028535.1 NZ_OX352944:c1868602-1868315 [Streptococcus suis]
MITINKDAQVNFKTDSRLLEKAKEVFAMNQLDLTAGFNLFLQNIAVKNELPILTEEELEREELFLQLQKEIQENQQAIEA
GHGISLESVKEKYGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Z8ZB64

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z9A6F4

References