Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1867996..1868602 | Replicon | chromosome |
| Accession | NZ_OX352944 | ||
| Organism | Streptococcus suis isolate 861160_LM_H | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | A0A0Z8ZB64 |
| Locus tag | QNH68_RS08980 | Protein ID | WP_012775364.1 |
| Coordinates | 1867996..1868325 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | D5AKB4 |
| Locus tag | QNH68_RS08985 | Protein ID | WP_012028535.1 |
| Coordinates | 1868315..1868602 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH68_RS08950 | 1864851..1865324 | - | 474 | WP_024378560.1 | IS200/IS605 family transposase | - |
| QNH68_RS08955 | 1865504..1866376 | - | 873 | WP_024387385.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
| QNH68_RS08960 | 1866395..1866925 | - | 531 | WP_074390182.1 | DUF1697 domain-containing protein | - |
| QNH68_RS08965 | 1866939..1867196 | - | 258 | WP_012775363.1 | Txe/YoeB family addiction module toxin | - |
| QNH68_RS08970 | 1867198..1867458 | - | 261 | WP_002939010.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| QNH68_RS08975 | 1867534..1867989 | - | 456 | WP_074390181.1 | 8-oxo-dGTP diphosphatase | - |
| QNH68_RS08980 | 1867996..1868325 | - | 330 | WP_012775364.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QNH68_RS08985 | 1868315..1868602 | - | 288 | WP_012028535.1 | hypothetical protein | Antitoxin |
| QNH68_RS08990 | 1868700..1869068 | - | 369 | WP_012775453.1 | hypothetical protein | - |
| QNH68_RS08995 | 1869061..1869630 | - | 570 | WP_012775700.1 | ribonuclease M5 | - |
| QNH68_RS09000 | 1869614..1870396 | - | 783 | WP_012028536.1 | TatD family hydrolase | - |
| QNH68_RS09005 | 1870503..1870640 | - | 138 | WP_002939016.1 | 50S ribosomal protein L34 | - |
| QNH68_RS09010 | 1870808..1871803 | - | 996 | WP_012775367.1 | RNA-binding cell elongation regulator Jag/EloR | - |
| QNH68_RS09015 | 1871823..1872635 | - | 813 | WP_012027897.1 | YidC/Oxa1 family membrane protein insertase | - |
| QNH68_RS09020 | 1872619..1872978 | - | 360 | WP_004194560.1 | ribonuclease P protein component | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1843516..1870396 | 26880 | |
| - | flank | IS/Tn | - | - | 1864851..1865324 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12562.52 Da Isoelectric Point: 7.1991
>T296682 WP_012775364.1 NZ_OX352944:c1868325-1867996 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Z8ZB64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Z9A6F4 |