Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 483603..484277 | Replicon | chromosome |
| Accession | NZ_OX352944 | ||
| Organism | Streptococcus suis isolate 861160_LM_H | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | V6Z2K9 |
| Locus tag | QNH68_RS02390 | Protein ID | WP_015647112.1 |
| Coordinates | 483603..483785 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QNH68_RS02395 | Protein ID | WP_074389768.1 |
| Coordinates | 483825..484277 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH68_RS02355 | 478722..479474 | + | 753 | WP_044758031.1 | DnaD domain protein | - |
| QNH68_RS02360 | 479484..480311 | + | 828 | WP_024381267.1 | ATP-binding protein | - |
| QNH68_RS02365 | 480753..480935 | + | 183 | WP_024405996.1 | hypothetical protein | - |
| QNH68_RS02370 | 481027..481638 | + | 612 | WP_024405995.1 | hypothetical protein | - |
| QNH68_RS02375 | 481685..482113 | + | 429 | WP_074389766.1 | replication protein | - |
| QNH68_RS02380 | 482121..482432 | + | 312 | WP_024405994.1 | hypothetical protein | - |
| QNH68_RS02385 | 482450..482863 | + | 414 | WP_024405993.1 | hypothetical protein | - |
| QNH68_RS02390 | 483603..483785 | + | 183 | WP_015647112.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QNH68_RS02395 | 483825..484277 | + | 453 | WP_074389768.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QNH68_RS02400 | 484391..484600 | + | 210 | WP_015647110.1 | hypothetical protein | - |
| QNH68_RS02405 | 485530..485751 | + | 222 | WP_012775256.1 | DUF6290 family protein | - |
| QNH68_RS02410 | 485753..486013 | + | 261 | WP_012027435.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QNH68_RS02415 | 486180..486821 | + | 642 | WP_023370899.1 | HAD family hydrolase | - |
| QNH68_RS02420 | 486854..487039 | - | 186 | WP_002935693.1 | hypothetical protein | - |
| QNH68_RS02425 | 487103..488107 | - | 1005 | WP_023370897.1 | lactonase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 475094..496154 | 21060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6630.84 Da Isoelectric Point: 10.8207
>T296675 WP_015647112.1 NZ_OX352944:483603-483785 [Streptococcus suis]
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16723.73 Da Isoelectric Point: 3.9495
>AT296675 WP_074389768.1 NZ_OX352944:483825-484277 [Streptococcus suis]
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|