Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
Location | 1620440..1621046 | Replicon | chromosome |
Accession | NZ_OX352941 | ||
Organism | Streptococcus suis isolate 861160_WT |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A0Z8ZB64 |
Locus tag | QNH71_RS07860 | Protein ID | WP_012775364.1 |
Coordinates | 1620440..1620769 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | D5AKB4 |
Locus tag | QNH71_RS07865 | Protein ID | WP_012028535.1 |
Coordinates | 1620759..1621046 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH71_RS07830 | 1617295..1617768 | - | 474 | WP_024378560.1 | IS200/IS605 family transposase | - |
QNH71_RS07835 | 1617948..1618820 | - | 873 | WP_024387385.1 | 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA | - |
QNH71_RS07840 | 1618839..1619369 | - | 531 | WP_074390182.1 | DUF1697 domain-containing protein | - |
QNH71_RS07845 | 1619383..1619640 | - | 258 | WP_012775363.1 | Txe/YoeB family addiction module toxin | - |
QNH71_RS07850 | 1619642..1619902 | - | 261 | WP_002939010.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
QNH71_RS07855 | 1619978..1620433 | - | 456 | WP_074390181.1 | 8-oxo-dGTP diphosphatase | - |
QNH71_RS07860 | 1620440..1620769 | - | 330 | WP_012775364.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QNH71_RS07865 | 1620759..1621046 | - | 288 | WP_012028535.1 | hypothetical protein | Antitoxin |
QNH71_RS07870 | 1621144..1621512 | - | 369 | WP_012775453.1 | hypothetical protein | - |
QNH71_RS07875 | 1621505..1622074 | - | 570 | WP_012775700.1 | ribonuclease M5 | - |
QNH71_RS07880 | 1622058..1622840 | - | 783 | WP_012028536.1 | TatD family hydrolase | - |
QNH71_RS07885 | 1622947..1623084 | - | 138 | WP_002939016.1 | 50S ribosomal protein L34 | - |
QNH71_RS07890 | 1623252..1624247 | - | 996 | WP_012775367.1 | RNA-binding cell elongation regulator Jag/EloR | - |
QNH71_RS07895 | 1624267..1625079 | - | 813 | WP_012027897.1 | YidC/Oxa1 family membrane protein insertase | - |
QNH71_RS07900 | 1625063..1625422 | - | 360 | WP_004194560.1 | ribonuclease P protein component | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1595960..1622840 | 26880 | |
- | flank | IS/Tn | - | - | 1617295..1617768 | 473 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12562.52 Da Isoelectric Point: 7.1991
>T296674 WP_012775364.1 NZ_OX352941:c1620769-1620440 [Streptococcus suis]
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
MEFESYSVILAPAVEKELAVIYAYFSEQFSEEIAKRRIGMIVEALESLQIFPERGFNADNRFGKQIDPPHLTRGYVVGKD
YIALYRVVKNEVRVGHLFATKSDYVKLLK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Z8ZB64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Z9A6F4 |