Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 237983..238466 Replicon chromosome
Accession NZ_OX352941
Organism Streptococcus suis isolate 861160_WT

Toxin (Protein)


Gene name relE Uniprot ID D5AIX4
Locus tag QNH71_RS01290 Protein ID WP_012027435.1
Coordinates 238206..238466 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Z8BIX7
Locus tag QNH71_RS01285 Protein ID WP_012775256.1
Coordinates 237983..238204 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNH71_RS01245 233206..233388 + 183 WP_024405996.1 hypothetical protein -
QNH71_RS01250 233480..234091 + 612 WP_024405995.1 hypothetical protein -
QNH71_RS01255 234138..234566 + 429 WP_074389766.1 replication protein -
QNH71_RS01260 234574..234885 + 312 WP_024405994.1 hypothetical protein -
QNH71_RS01265 234903..235316 + 414 WP_024405993.1 hypothetical protein -
QNH71_RS01270 236056..236238 + 183 WP_015647112.1 type II toxin-antitoxin system HicA family toxin -
QNH71_RS01275 236278..236730 + 453 WP_074389768.1 type II toxin-antitoxin system HicB family antitoxin -
QNH71_RS01280 236844..237053 + 210 WP_015647110.1 hypothetical protein -
QNH71_RS01285 237983..238204 + 222 WP_012775256.1 DUF6290 family protein Antitoxin
QNH71_RS01290 238206..238466 + 261 WP_012027435.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QNH71_RS01295 238633..239274 + 642 WP_023370899.1 HAD family hydrolase -
QNH71_RS01300 239307..239492 - 186 WP_002935693.1 hypothetical protein -
QNH71_RS01305 239556..240560 - 1005 WP_023370897.1 lactonase family protein -
QNH71_RS01310 240696..241862 + 1167 WP_012775254.1 AI-2E family transporter -
QNH71_RS01315 241852..243081 + 1230 WP_023370895.1 tetratricopeptide repeat protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 227547..248607 21060


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10273.79 Da        Isoelectric Point: 9.3944

>T296668 WP_012027435.1 NZ_OX352941:238206-238466 [Streptococcus suis]
MYHLEYSKKAQKQIMKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8566.55 Da        Isoelectric Point: 4.4791

>AT296668 WP_012775256.1 NZ_OX352941:237983-238204 [Streptococcus suis]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K1T1M7

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8BIX7

References