Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 236056..236730 | Replicon | chromosome |
| Accession | NZ_OX352941 | ||
| Organism | Streptococcus suis isolate 861160_WT | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | V6Z2K9 |
| Locus tag | QNH71_RS01270 | Protein ID | WP_015647112.1 |
| Coordinates | 236056..236238 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QNH71_RS01275 | Protein ID | WP_074389768.1 |
| Coordinates | 236278..236730 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH71_RS01235 | 231175..231927 | + | 753 | WP_044758031.1 | DnaD domain protein | - |
| QNH71_RS01240 | 231937..232764 | + | 828 | WP_024381267.1 | ATP-binding protein | - |
| QNH71_RS01245 | 233206..233388 | + | 183 | WP_024405996.1 | hypothetical protein | - |
| QNH71_RS01250 | 233480..234091 | + | 612 | WP_024405995.1 | hypothetical protein | - |
| QNH71_RS01255 | 234138..234566 | + | 429 | WP_074389766.1 | replication protein | - |
| QNH71_RS01260 | 234574..234885 | + | 312 | WP_024405994.1 | hypothetical protein | - |
| QNH71_RS01265 | 234903..235316 | + | 414 | WP_024405993.1 | hypothetical protein | - |
| QNH71_RS01270 | 236056..236238 | + | 183 | WP_015647112.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QNH71_RS01275 | 236278..236730 | + | 453 | WP_074389768.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QNH71_RS01280 | 236844..237053 | + | 210 | WP_015647110.1 | hypothetical protein | - |
| QNH71_RS01285 | 237983..238204 | + | 222 | WP_012775256.1 | DUF6290 family protein | - |
| QNH71_RS01290 | 238206..238466 | + | 261 | WP_012027435.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QNH71_RS01295 | 238633..239274 | + | 642 | WP_023370899.1 | HAD family hydrolase | - |
| QNH71_RS01300 | 239307..239492 | - | 186 | WP_002935693.1 | hypothetical protein | - |
| QNH71_RS01305 | 239556..240560 | - | 1005 | WP_023370897.1 | lactonase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 227547..248607 | 21060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6630.84 Da Isoelectric Point: 10.8207
>T296667 WP_015647112.1 NZ_OX352941:236056-236238 [Streptococcus suis]
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16723.73 Da Isoelectric Point: 3.9495
>AT296667 WP_074389768.1 NZ_OX352941:236278-236730 [Streptococcus suis]
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|