Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 997406..997889 Replicon chromosome
Accession NZ_OX352940
Organism Streptococcus suis isolate 861160_LM_A

Toxin (Protein)


Gene name relE Uniprot ID D5AIX4
Locus tag QNH65_RS04770 Protein ID WP_012027435.1
Coordinates 997406..997666 (-) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Z8BIX7
Locus tag QNH65_RS04775 Protein ID WP_012775256.1
Coordinates 997668..997889 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNH65_RS04745 992791..994020 - 1230 WP_023370895.1 tetratricopeptide repeat protein -
QNH65_RS04750 994010..995176 - 1167 WP_012775254.1 AI-2E family transporter -
QNH65_RS04755 995312..996316 + 1005 WP_023370897.1 lactonase family protein -
QNH65_RS04760 996380..996565 + 186 WP_002935693.1 hypothetical protein -
QNH65_RS04765 996598..997239 - 642 WP_023370899.1 HAD family hydrolase -
QNH65_RS04770 997406..997666 - 261 WP_012027435.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QNH65_RS04775 997668..997889 - 222 WP_012775256.1 DUF6290 family protein Antitoxin
QNH65_RS04780 998819..999028 - 210 WP_015647110.1 hypothetical protein -
QNH65_RS04785 999142..999594 - 453 WP_074389768.1 type II toxin-antitoxin system HicB family antitoxin -
QNH65_RS04790 999634..999816 - 183 WP_015647112.1 type II toxin-antitoxin system HicA family toxin -
QNH65_RS04795 1000556..1000969 - 414 WP_024405993.1 hypothetical protein -
QNH65_RS04800 1000987..1001298 - 312 WP_024405994.1 hypothetical protein -
QNH65_RS04805 1001306..1001734 - 429 WP_074389766.1 replication protein -
QNH65_RS04810 1001781..1002392 - 612 WP_024405995.1 hypothetical protein -
QNH65_RS04815 1002484..1002666 - 183 WP_024405996.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 996380..1008325 11945


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10273.79 Da        Isoelectric Point: 9.3944

>T296663 WP_012027435.1 NZ_OX352940:c997666-997406 [Streptococcus suis]
MYHLEYSKKAQKQIMKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8566.55 Da        Isoelectric Point: 4.4791

>AT296663 WP_012775256.1 NZ_OX352940:c997889-997668 [Streptococcus suis]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K1T1M7

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8BIX7

References