296652

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 572056..572539 Replicon chromosome
Accession NZ_OX352831
Organism Streptococcus suis isolate 861160_dxerD_hsdSE

Toxin (Protein)


Gene name relE Uniprot ID D5AIX4
Locus tag QNH78_RS02970 Protein ID WP_012027435.1
Coordinates 572279..572539 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Z8BIX7
Locus tag QNH78_RS02965 Protein ID WP_012775256.1
Coordinates 572056..572277 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNH78_RS02925 567279..567461 + 183 WP_024405996.1 hypothetical protein -
QNH78_RS02930 567553..568164 + 612 WP_024405995.1 hypothetical protein -
QNH78_RS02935 568211..568639 + 429 WP_074389766.1 replication protein -
QNH78_RS02940 568647..568958 + 312 WP_024405994.1 hypothetical protein -
QNH78_RS02945 568976..569389 + 414 WP_024405993.1 hypothetical protein -
QNH78_RS02950 570129..570311 + 183 WP_015647112.1 type II toxin-antitoxin system HicA family toxin -
QNH78_RS02955 570351..570803 + 453 WP_074389768.1 type II toxin-antitoxin system HicB family antitoxin -
QNH78_RS02960 570917..571126 + 210 WP_015647110.1 hypothetical protein -
QNH78_RS02965 572056..572277 + 222 WP_012775256.1 DUF6290 family protein Antitoxin
QNH78_RS02970 572279..572539 + 261 WP_012027435.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QNH78_RS02975 572706..573347 + 642 WP_023370899.1 HAD family hydrolase -
QNH78_RS02980 573380..573565 - 186 WP_002935693.1 hypothetical protein -
QNH78_RS02985 573629..574633 - 1005 WP_023370897.1 lactonase family protein -
QNH78_RS02990 574769..575935 + 1167 WP_012775254.1 AI-2E family transporter -
QNH78_RS02995 575925..577154 + 1230 WP_023370895.1 tetratricopeptide repeat protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 561620..580224 18604


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 10273.79 Da        Isoelectric Point: 9.3944

>T296652 WP_012027435.1 NZ_OX352831:572279-572539 [Streptococcus suis]
MYHLEYSKKAQKQIMKLDRQIQRLLFAWIDKHLEGTDNPRANGKGLTGNHANEWRYRIGDYRLICDIQDDKLVILALEFG
HRKDVY

Download         Length: 261 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8566.55 Da        Isoelectric Point: 4.4791

>AT296652 WP_012775256.1 NZ_OX352831:572056-572277 [Streptococcus suis]
MSTVTIRLNQEEEVFFKSYAQLTGQSLSSLFKKALERDIEDEYDLKIYHQAYDEYKADPETISHADFKKELGL

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K1T1M7

Antitoxin

Source ID Structure
AlphaFold DB A0A0Z8BIX7

References