Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 570129..570803 | Replicon | chromosome |
| Accession | NZ_OX352831 | ||
| Organism | Streptococcus suis isolate 861160_dxerD_hsdSE | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | V6Z2K9 |
| Locus tag | QNH78_RS02950 | Protein ID | WP_015647112.1 |
| Coordinates | 570129..570311 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QNH78_RS02955 | Protein ID | WP_074389768.1 |
| Coordinates | 570351..570803 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH78_RS02915 | 565248..566000 | + | 753 | WP_044758031.1 | DnaD domain protein | - |
| QNH78_RS02920 | 566010..566837 | + | 828 | WP_024381267.1 | ATP-binding protein | - |
| QNH78_RS02925 | 567279..567461 | + | 183 | WP_024405996.1 | hypothetical protein | - |
| QNH78_RS02930 | 567553..568164 | + | 612 | WP_024405995.1 | hypothetical protein | - |
| QNH78_RS02935 | 568211..568639 | + | 429 | WP_074389766.1 | replication protein | - |
| QNH78_RS02940 | 568647..568958 | + | 312 | WP_024405994.1 | hypothetical protein | - |
| QNH78_RS02945 | 568976..569389 | + | 414 | WP_024405993.1 | hypothetical protein | - |
| QNH78_RS02950 | 570129..570311 | + | 183 | WP_015647112.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QNH78_RS02955 | 570351..570803 | + | 453 | WP_074389768.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QNH78_RS02960 | 570917..571126 | + | 210 | WP_015647110.1 | hypothetical protein | - |
| QNH78_RS02965 | 572056..572277 | + | 222 | WP_012775256.1 | DUF6290 family protein | - |
| QNH78_RS02970 | 572279..572539 | + | 261 | WP_012027435.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QNH78_RS02975 | 572706..573347 | + | 642 | WP_023370899.1 | HAD family hydrolase | - |
| QNH78_RS02980 | 573380..573565 | - | 186 | WP_002935693.1 | hypothetical protein | - |
| QNH78_RS02985 | 573629..574633 | - | 1005 | WP_023370897.1 | lactonase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 561620..580224 | 18604 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6630.84 Da Isoelectric Point: 10.8207
>T296651 WP_015647112.1 NZ_OX352831:570129-570311 [Streptococcus suis]
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16723.73 Da Isoelectric Point: 3.9495
>AT296651 WP_074389768.1 NZ_OX352831:570351-570803 [Streptococcus suis]
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|