Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 570318..570992 | Replicon | chromosome |
| Accession | NZ_OX352806 | ||
| Organism | Streptococcus suis isolate 861160_dxerD_hsdSA | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | V6Z2K9 |
| Locus tag | QNH74_RS02945 | Protein ID | WP_015647112.1 |
| Coordinates | 570318..570500 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QNH74_RS02950 | Protein ID | WP_074389768.1 |
| Coordinates | 570540..570992 (+) | Length | 151 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH74_RS02910 | 565437..566189 | + | 753 | WP_044758031.1 | DnaD domain protein | - |
| QNH74_RS02915 | 566199..567026 | + | 828 | WP_024381267.1 | ATP-binding protein | - |
| QNH74_RS02920 | 567468..567650 | + | 183 | WP_024405996.1 | hypothetical protein | - |
| QNH74_RS02925 | 567742..568353 | + | 612 | WP_024405995.1 | hypothetical protein | - |
| QNH74_RS02930 | 568400..568828 | + | 429 | WP_074389766.1 | replication protein | - |
| QNH74_RS02935 | 568836..569147 | + | 312 | WP_024405994.1 | hypothetical protein | - |
| QNH74_RS02940 | 569165..569578 | + | 414 | WP_024405993.1 | hypothetical protein | - |
| QNH74_RS02945 | 570318..570500 | + | 183 | WP_015647112.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QNH74_RS02950 | 570540..570992 | + | 453 | WP_074389768.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QNH74_RS02955 | 571106..571315 | + | 210 | WP_015647110.1 | hypothetical protein | - |
| QNH74_RS02960 | 572245..572466 | + | 222 | WP_012775256.1 | DUF6290 family protein | - |
| QNH74_RS02965 | 572468..572728 | + | 261 | WP_012027435.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QNH74_RS02970 | 572895..573536 | + | 642 | WP_023370899.1 | HAD family hydrolase | - |
| QNH74_RS02975 | 573569..573754 | - | 186 | WP_002935693.1 | hypothetical protein | - |
| QNH74_RS02980 | 573818..574822 | - | 1005 | WP_023370897.1 | lactonase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 561809..580413 | 18604 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6630.84 Da Isoelectric Point: 10.8207
>T296643 WP_015647112.1 NZ_OX352806:570318-570500 [Streptococcus suis]
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
MPMTQKEMVKLLTANGWTKTKGGKGSHVKLEKAGERPITIPHGEINKYTERGIKKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 151 a.a. Molecular weight: 16723.73 Da Isoelectric Point: 3.9495
>AT296643 WP_074389768.1 NZ_OX352806:570540-570992 [Streptococcus suis]
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
MLVTYPALFYYDDTDGASAPYFVTFPDFEHSATQGEDMANAMAMASDWLGIHLADYIENGRDIPIPTPINTLSLADNNPF
HDDEDIELIYDPSKSFISMVMVDVAEYLGSQEPIKKTLTIPRWADTLGRELGLNFSQTLTDAIADKKIHA
Download Length: 453 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|