Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 5373112..5373740 | Replicon | chromosome |
Accession | NZ_OX352324 | ||
Organism | Pseudomonas sp. MM221 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | OM991_RS25180 | Protein ID | WP_234229625.1 |
Coordinates | 5373558..5373740 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OM991_RS25175 | Protein ID | WP_264363461.1 |
Coordinates | 5373112..5373534 (-) | Length | 141 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM991_RS25160 (GLGCALEP_05225) | 5368303..5369016 | - | 714 | WP_264360528.1 | serine O-acetyltransferase | - |
OM991_RS25165 (GLGCALEP_05226) | 5369188..5370528 | + | 1341 | WP_264360529.1 | PLP-dependent aminotransferase family protein | - |
OM991_RS25170 (GLGCALEP_05227) | 5370632..5373073 | + | 2442 | WP_264360530.1 | penicillin acylase family protein | - |
OM991_RS25175 (GLGCALEP_05228) | 5373112..5373534 | - | 423 | WP_264363461.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OM991_RS25180 (GLGCALEP_05229) | 5373558..5373740 | - | 183 | WP_234229625.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OM991_RS25185 (GLGCALEP_05230) | 5373948..5374964 | + | 1017 | WP_264360531.1 | ligase-associated DNA damage response exonuclease | - |
OM991_RS25190 (GLGCALEP_05231) | 5374961..5376619 | + | 1659 | WP_264360532.1 | ATP-dependent DNA ligase | - |
OM991_RS25195 (GLGCALEP_05232) | 5376780..5377894 | + | 1115 | Protein_4946 | M14 family metallopeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6851.00 Da Isoelectric Point: 11.0323
>T296641 WP_234229625.1 NZ_OX352324:c5373740-5373558 [Pseudomonas sp. MM221]
MKYSEFRRWLRGQGATFVAAKGSHFKVYLGNRQTIFPDHGAKEISEGLRKKILKDLGLKA
MKYSEFRRWLRGQGATFVAAKGSHFKVYLGNRQTIFPDHGAKEISEGLRKKILKDLGLKA
Download Length: 183 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15320.57 Da Isoelectric Point: 4.9323
>AT296641 WP_264363461.1 NZ_OX352324:c5373534-5373112 [Pseudomonas sp. MM221]
IFEYPVVVHQEDGSVWVSCPDVPEMACAGDTSEEALFDAVDALESALSFYVDQKHAIPLPSAPTEGHPVVRLPALTAAKA
ALWNTMVAQKISKTEMARRLGVNRPQVDRLVDLLHRSKIEQVEHALNVLGQRIELSVVAV
IFEYPVVVHQEDGSVWVSCPDVPEMACAGDTSEEALFDAVDALESALSFYVDQKHAIPLPSAPTEGHPVVRLPALTAAKA
ALWNTMVAQKISKTEMARRLGVNRPQVDRLVDLLHRSKIEQVEHALNVLGQRIELSVVAV
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|