Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 5040570..5041158 | Replicon | chromosome |
| Accession | NZ_OX352324 | ||
| Organism | Pseudomonas sp. MM221 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | OM991_RS23600 | Protein ID | WP_264360335.1 |
| Coordinates | 5040570..5040872 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | OM991_RS23605 | Protein ID | WP_264360336.1 |
| Coordinates | 5040865..5041158 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM991_RS23575 | 5036414..5036542 | - | 129 | WP_009683677.1 | PA1414 family protein | - |
| OM991_RS23580 (GLGCALEP_04900) | 5036667..5037559 | - | 893 | Protein_4631 | LysR substrate-binding domain-containing protein | - |
| OM991_RS23585 (GLGCALEP_04901) | 5037666..5038835 | + | 1170 | WP_264360332.1 | MFS transporter | - |
| OM991_RS23590 (GLGCALEP_04902) | 5038963..5039889 | - | 927 | WP_264360333.1 | DMT family transporter | - |
| OM991_RS23595 (GLGCALEP_04903) | 5039996..5040391 | - | 396 | WP_264360334.1 | transcriptional regulator | - |
| OM991_RS23600 | 5040570..5040872 | + | 303 | WP_264360335.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OM991_RS23605 (GLGCALEP_04904) | 5040865..5041158 | + | 294 | WP_264360336.1 | putative addiction module antidote protein | Antitoxin |
| OM991_RS23610 (GLGCALEP_04905) | 5041244..5041516 | + | 273 | WP_105946027.1 | hypothetical protein | - |
| OM991_RS23615 (GLGCALEP_04907) | 5041637..5042996 | - | 1360 | Protein_4638 | DEAD/DEAH box helicase | - |
| OM991_RS23620 (GLGCALEP_04908) | 5043100..5044398 | + | 1299 | WP_264360337.1 | mechanosensitive ion channel family protein | - |
| OM991_RS23625 (GLGCALEP_04909) | 5044513..5045448 | - | 936 | WP_264360338.1 | AEC family transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11421.10 Da Isoelectric Point: 10.8773
>T296640 WP_264360335.1 NZ_OX352324:5040570-5040872 [Pseudomonas sp. MM221]
MKKIESSSFRHWVTGLRDVNARARIISRINRLMEGLPGDVSPVGQGISELRIHYGPGYRVYFHQVGSTFVILLCGGEKSS
QQRDIKTAHQILRSWRIQND
MKKIESSSFRHWVTGLRDVNARARIISRINRLMEGLPGDVSPVGQGISELRIHYGPGYRVYFHQVGSTFVILLCGGEKSS
QQRDIKTAHQILRSWRIQND
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|