Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 4196127..4196643 | Replicon | chromosome |
Accession | NZ_OX352324 | ||
Organism | Pseudomonas sp. MM221 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OM991_RS19505 | Protein ID | WP_264359765.1 |
Coordinates | 4196127..4196408 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OM991_RS19510 | Protein ID | WP_264359766.1 |
Coordinates | 4196398..4196643 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM991_RS19490 (GLGCALEP_04051) | 4192465..4193706 | - | 1242 | WP_264359763.1 | Zn-dependent hydrolase | - |
OM991_RS19495 (GLGCALEP_04052) | 4193737..4195041 | - | 1305 | WP_264359764.1 | MFS transporter | - |
OM991_RS19500 (GLGCALEP_04054) | 4195223..4196130 | + | 908 | Protein_3829 | LysR family transcriptional regulator | - |
OM991_RS19505 (GLGCALEP_04055) | 4196127..4196408 | - | 282 | WP_264359765.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM991_RS19510 (GLGCALEP_04056) | 4196398..4196643 | - | 246 | WP_264359766.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OM991_RS19515 (GLGCALEP_04057) | 4196863..4197660 | + | 798 | WP_264359767.1 | SDR family oxidoreductase | - |
OM991_RS19520 (GLGCALEP_04058) | 4197682..4198089 | + | 408 | WP_264359768.1 | SRPBCC family protein | - |
OM991_RS19525 (GLGCALEP_04059) | 4198208..4199194 | + | 987 | WP_264359769.1 | zinc-binding dehydrogenase | - |
OM991_RS19530 (GLGCALEP_04060) | 4199302..4199843 | + | 542 | Protein_3835 | WYL domain-containing protein | - |
OM991_RS19535 (GLGCALEP_04062) | 4199941..4200876 | + | 936 | WP_264359770.1 | cyclase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10853.72 Da Isoelectric Point: 10.7594
>T296638 WP_264359765.1 NZ_OX352324:c4196408-4196127 [Pseudomonas sp. MM221]
MTYKLEFLPSALKEWGKLGHTVREQIKKKLGERLQSPKVQADALRDLANHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRAAQKR
MTYKLEFLPSALKEWGKLGHTVREQIKKKLGERLQSPKVQADALRDLANHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRAAQKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|