Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 3567531..3568120 Replicon chromosome
Accession NZ_OX352324
Organism Pseudomonas sp. MM221

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag OM991_RS16725 Protein ID WP_264359336.1
Coordinates 3567872..3568120 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag OM991_RS16720 Protein ID WP_264359335.1
Coordinates 3567531..3567872 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM991_RS16680 (GLGCALEP_03462) 3562572..3562883 - 312 WP_140174336.1 transposase family protein -
OM991_RS16685 (GLGCALEP_03463) 3562886..3563119 - 234 WP_264359329.1 helix-turn-helix domain-containing protein -
OM991_RS16690 (GLGCALEP_03464) 3563222..3563956 + 735 WP_264359330.1 S24 family peptidase -
OM991_RS16695 (GLGCALEP_03465) 3563959..3564183 + 225 WP_264359331.1 hypothetical protein -
OM991_RS16700 (GLGCALEP_03466) 3564180..3564434 + 255 WP_047934733.1 prophage PssSM-02 -
OM991_RS16705 (GLGCALEP_03467) 3564986..3565852 + 867 WP_264359332.1 ATP-binding protein -
OM991_RS16710 3565957..3566430 + 474 WP_264359333.1 hypothetical protein -
OM991_RS16715 (GLGCALEP_03469) 3566512..3567390 + 879 WP_264359334.1 DNA adenine methylase -
OM991_RS16720 (GLGCALEP_03470) 3567531..3567872 - 342 WP_264359335.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OM991_RS16725 (GLGCALEP_03471) 3567872..3568120 - 249 WP_264359336.1 type II toxin-antitoxin system HicA family toxin Toxin
OM991_RS16730 (GLGCALEP_03472) 3568268..3568525 + 258 WP_264359337.1 DUF1654 domain-containing protein -
OM991_RS16735 (GLGCALEP_03473) 3568997..3569218 + 222 WP_232894495.1 hypothetical protein -
OM991_RS16740 (GLGCALEP_03474) 3569282..3569482 + 201 WP_264359338.1 hypothetical protein -
OM991_RS16745 (GLGCALEP_03475) 3569798..3570088 + 291 WP_264359339.1 hypothetical protein -
OM991_RS16750 (GLGCALEP_03476) 3570085..3570291 + 207 WP_256824908.1 DUF551 domain-containing protein -
OM991_RS16755 (GLGCALEP_03477) 3570312..3570635 + 324 WP_256806907.1 hypothetical protein -
OM991_RS16760 (GLGCALEP_03478) 3570632..3570862 + 231 WP_103462665.1 hypothetical protein -
OM991_RS16765 (GLGCALEP_03479) 3571063..3571200 - 138 WP_158238196.1 hypothetical protein -
OM991_RS16770 (GLGCALEP_03480) 3571199..3571738 + 540 WP_080604853.1 HNH endonuclease signature motif containing protein -
OM991_RS16775 (GLGCALEP_03481) 3571793..3572617 + 825 WP_264359340.1 phage recombination protein Bet -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3526809..3587321 60512


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-76)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9128.66 Da        Isoelectric Point: 10.4156

>T296637 WP_264359336.1 NZ_OX352324:c3568120-3567872 [Pseudomonas sp. MM221]
MSKQEKLLAKLLNKQAGFTWPELVTLLGGLGYRQIEGDGSRVKFDNGHPQAMINLHKPHPGNELKAYVKRQVIEHLKAGG
LI

Download         Length: 249 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12418.86 Da        Isoelectric Point: 4.8161

>AT296637 WP_264359335.1 NZ_OX352324:c3567872-3567531 [Pseudomonas sp. MM221]
MSTMLQHRGYYGSIEASPEDNCLFGKLQFIRALVSYEGETVAELTQAFRDAVDDYLDTCASLGQEPEIPCKGSFNVRVGH
DLHLAASVAATQQNISLNDLTRKALSEYLGHHA

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References