Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 1256400..1257084 | Replicon | chromosome |
| Accession | NZ_OX352324 | ||
| Organism | Pseudomonas sp. MM221 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | - |
| Locus tag | OM991_RS05805 | Protein ID | WP_264361875.1 |
| Coordinates | 1256713..1257084 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | - |
| Locus tag | OM991_RS05800 | Protein ID | WP_264361874.1 |
| Coordinates | 1256400..1256720 (-) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM991_RS05775 (GLGCALEP_01209) | 1252587..1252988 | + | 402 | WP_086979063.1 | FagA protein | - |
| OM991_RS05780 | 1252981..1254355 | + | 1375 | Protein_1120 | class II fumarate hydratase | - |
| OM991_RS05785 (GLGCALEP_01212) | 1254384..1254845 | + | 462 | WP_264361872.1 | DUF2753 domain-containing protein | - |
| OM991_RS05790 (GLGCALEP_01213) | 1254847..1255458 | + | 612 | WP_264361873.1 | superoxide dismutase | - |
| OM991_RS05795 (GLGCALEP_01214) | 1255470..1256363 | + | 894 | WP_234227567.1 | ZIP family metal transporter | - |
| OM991_RS05800 (GLGCALEP_01215) | 1256400..1256720 | - | 321 | WP_264361874.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OM991_RS05805 (GLGCALEP_01216) | 1256713..1257084 | - | 372 | WP_264361875.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OM991_RS05810 (GLGCALEP_01217) | 1257173..1257445 | - | 273 | WP_010952144.1 | HPr family phosphocarrier protein | - |
| OM991_RS05815 (GLGCALEP_01218) | 1257465..1258319 | - | 855 | WP_264361876.1 | RNase adapter RapZ | - |
| OM991_RS05820 (GLGCALEP_01219) | 1258322..1258786 | - | 465 | WP_019471369.1 | PTS IIA-like nitrogen regulatory protein PtsN | - |
| OM991_RS05825 (GLGCALEP_01220) | 1258799..1259107 | - | 309 | WP_016485037.1 | ribosome-associated translation inhibitor RaiA | - |
| OM991_RS05830 (GLGCALEP_01221) | 1259187..1260680 | - | 1494 | WP_264361877.1 | RNA polymerase factor sigma-54 | - |
| OM991_RS05835 (GLGCALEP_01222) | 1260857..1261582 | - | 726 | WP_003255132.1 | LPS export ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13667.52 Da Isoelectric Point: 9.4692
>T296635 WP_264361875.1 NZ_OX352324:c1257084-1256713 [Pseudomonas sp. MM221]
MDALKRIRALYWVGSSKKDLQALPEDVQDIFGFALHLAQEGGKHQQTKCLKGFSGAGVLEVMEDHNRNTYRAVYTVSFGS
AVYVLHCFQKKSTSGIKTSSHDIALIRSRLKLAEAHSRGDTND
MDALKRIRALYWVGSSKKDLQALPEDVQDIFGFALHLAQEGGKHQQTKCLKGFSGAGVLEVMEDHNRNTYRAVYTVSFGS
AVYVLHCFQKKSTSGIKTSSHDIALIRSRLKLAEAHSRGDTND
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|