Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 806344..807037 | Replicon | chromosome |
Accession | NZ_OX352324 | ||
Organism | Pseudomonas sp. MM221 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | OM991_RS03690 | Protein ID | WP_003151133.1 |
Coordinates | 806660..807037 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | OM991_RS03685 | Protein ID | WP_001172026.1 |
Coordinates | 806344..806679 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM991_RS03655 | 802663..802908 | - | 246 | Protein_698 | DUF4113 domain-containing protein | - |
OM991_RS03660 | 803142..803597 | + | 456 | WP_023660738.1 | glyoxalase superfamily protein | - |
OM991_RS03665 (GLGCALEP_00757) | 803870..804739 | - | 870 | WP_223198360.1 | HD-GYP domain-containing protein | - |
OM991_RS31375 | 804823..805110 | - | 288 | WP_269841825.1 | DUF3391 domain-containing protein | - |
OM991_RS03670 (GLGCALEP_00758) | 805267..805647 | - | 381 | WP_001054412.1 | hypothetical protein | - |
OM991_RS03675 (GLGCALEP_00759) | 805644..805970 | - | 327 | WP_000091614.1 | hypothetical protein | - |
OM991_RS03680 (GLGCALEP_00760) | 805994..806329 | - | 336 | WP_000741275.1 | hypothetical protein | - |
OM991_RS03685 (GLGCALEP_00761) | 806344..806679 | - | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OM991_RS03690 (GLGCALEP_00762) | 806660..807037 | - | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM991_RS03695 (GLGCALEP_00763) | 807229..807831 | + | 603 | WP_010465829.1 | recombinase family protein | - |
OM991_RS03700 | 807815..810889 | + | 3075 | Protein_708 | Tn3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 773376..866581 | 93205 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T296634 WP_003151133.1 NZ_OX352324:c807037-806660 [Pseudomonas sp. MM221]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |