Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 5374310..5374938 | Replicon | chromosome |
Accession | NZ_OX352322 | ||
Organism | Pseudomonas sp. MM223 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | ONI07_RS25020 | Protein ID | WP_234229625.1 |
Coordinates | 5374756..5374938 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | ONI07_RS25015 | Protein ID | WP_264363461.1 |
Coordinates | 5374310..5374732 (-) | Length | 141 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONI07_RS25000 (DBADOPDK_05103) | 5369500..5370213 | - | 714 | WP_264360528.1 | serine O-acetyltransferase | - |
ONI07_RS25005 (DBADOPDK_05104) | 5370386..5371726 | + | 1341 | WP_264360529.1 | PLP-dependent aminotransferase family protein | - |
ONI07_RS25010 (DBADOPDK_05105) | 5371830..5374271 | + | 2442 | WP_264360530.1 | penicillin acylase family protein | - |
ONI07_RS25015 (DBADOPDK_05106) | 5374310..5374732 | - | 423 | WP_264363461.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
ONI07_RS25020 (DBADOPDK_05107) | 5374756..5374938 | - | 183 | WP_234229625.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
ONI07_RS25025 (DBADOPDK_05108) | 5375146..5376162 | + | 1017 | WP_264360531.1 | ligase-associated DNA damage response exonuclease | - |
ONI07_RS25030 (DBADOPDK_05109) | 5376159..5377817 | + | 1659 | WP_264360532.1 | ATP-dependent DNA ligase | - |
ONI07_RS25035 (DBADOPDK_05110) | 5377978..5379093 | + | 1116 | WP_264387184.1 | M14 family metallopeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6851.00 Da Isoelectric Point: 11.0323
>T296631 WP_234229625.1 NZ_OX352322:c5374938-5374756 [Pseudomonas sp. MM223]
MKYSEFRRWLRGQGATFVAAKGSHFKVYLGNRQTIFPDHGAKEISEGLRKKILKDLGLKA
MKYSEFRRWLRGQGATFVAAKGSHFKVYLGNRQTIFPDHGAKEISEGLRKKILKDLGLKA
Download Length: 183 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15320.57 Da Isoelectric Point: 4.9323
>AT296631 WP_264363461.1 NZ_OX352322:c5374732-5374310 [Pseudomonas sp. MM223]
IFEYPVVVHQEDGSVWVSCPDVPEMACAGDTSEEALFDAVDALESALSFYVDQKHAIPLPSAPTEGHPVVRLPALTAAKA
ALWNTMVAQKISKTEMARRLGVNRPQVDRLVDLLHRSKIEQVEHALNVLGQRIELSVVAV
IFEYPVVVHQEDGSVWVSCPDVPEMACAGDTSEEALFDAVDALESALSFYVDQKHAIPLPSAPTEGHPVVRLPALTAAKA
ALWNTMVAQKISKTEMARRLGVNRPQVDRLVDLLHRSKIEQVEHALNVLGQRIELSVVAV
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|