Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5041685..5042273 | Replicon | chromosome |
Accession | NZ_OX352322 | ||
Organism | Pseudomonas sp. MM223 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | ONI07_RS23440 | Protein ID | WP_264360335.1 |
Coordinates | 5041685..5041987 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | ONI07_RS23445 | Protein ID | WP_264360336.1 |
Coordinates | 5041980..5042273 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONI07_RS23415 | 5037526..5037654 | - | 129 | WP_009683677.1 | PA1414 family protein | - |
ONI07_RS23420 (DBADOPDK_04781) | 5037779..5038672 | - | 894 | WP_264387151.1 | LysR family transcriptional regulator | - |
ONI07_RS23425 (DBADOPDK_04782) | 5038779..5039948 | + | 1170 | WP_264360332.1 | MFS transporter | - |
ONI07_RS23430 (DBADOPDK_04783) | 5040078..5041004 | - | 927 | WP_264360333.1 | DMT family transporter | - |
ONI07_RS23435 (DBADOPDK_04784) | 5041111..5041506 | - | 396 | WP_264360334.1 | transcriptional regulator | - |
ONI07_RS23440 | 5041685..5041987 | + | 303 | WP_264360335.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ONI07_RS23445 (DBADOPDK_04785) | 5041980..5042273 | + | 294 | WP_264360336.1 | putative addiction module antidote protein | Antitoxin |
ONI07_RS23450 (DBADOPDK_04786) | 5042359..5042631 | + | 273 | WP_105946027.1 | hypothetical protein | - |
ONI07_RS23455 (DBADOPDK_04788) | 5042752..5044112 | - | 1361 | Protein_4609 | DEAD/DEAH box helicase | - |
ONI07_RS23460 (DBADOPDK_04789) | 5044216..5045514 | + | 1299 | WP_264360337.1 | mechanosensitive ion channel family protein | - |
ONI07_RS23465 (DBADOPDK_04790) | 5045629..5046564 | - | 936 | WP_264360338.1 | AEC family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11421.10 Da Isoelectric Point: 10.8773
>T296630 WP_264360335.1 NZ_OX352322:5041685-5041987 [Pseudomonas sp. MM223]
MKKIESSSFRHWVTGLRDVNARARIISRINRLMEGLPGDVSPVGQGISELRIHYGPGYRVYFHQVGSTFVILLCGGEKSS
QQRDIKTAHQILRSWRIQND
MKKIESSSFRHWVTGLRDVNARARIISRINRLMEGLPGDVSPVGQGISELRIHYGPGYRVYFHQVGSTFVILLCGGEKSS
QQRDIKTAHQILRSWRIQND
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|