Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 4197086..4197602 | Replicon | chromosome |
Accession | NZ_OX352322 | ||
Organism | Pseudomonas sp. MM223 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | ONI07_RS19365 | Protein ID | WP_264359765.1 |
Coordinates | 4197086..4197367 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | ONI07_RS19370 | Protein ID | WP_264359766.1 |
Coordinates | 4197357..4197602 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONI07_RS19350 (DBADOPDK_03951) | 4193421..4194662 | - | 1242 | WP_264359763.1 | Zn-dependent hydrolase | - |
ONI07_RS19355 | 4194693..4195999 | - | 1307 | Protein_3803 | MHS family MFS transporter | - |
ONI07_RS19360 (DBADOPDK_03954) | 4196181..4197089 | + | 909 | WP_264387067.1 | LysR family transcriptional regulator | - |
ONI07_RS19365 (DBADOPDK_03955) | 4197086..4197367 | - | 282 | WP_264359765.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ONI07_RS19370 (DBADOPDK_03956) | 4197357..4197602 | - | 246 | WP_264359766.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
ONI07_RS19375 (DBADOPDK_03957) | 4197822..4198619 | + | 798 | WP_264359767.1 | SDR family oxidoreductase | - |
ONI07_RS19380 (DBADOPDK_03958) | 4198641..4199048 | + | 408 | WP_264359768.1 | SRPBCC family protein | - |
ONI07_RS19385 (DBADOPDK_03959) | 4199168..4200154 | + | 987 | WP_264359769.1 | zinc-binding dehydrogenase | - |
ONI07_RS19390 (DBADOPDK_03960) | 4200262..4200804 | + | 543 | WP_264387068.1 | WYL domain-containing protein | - |
ONI07_RS19395 (DBADOPDK_03961) | 4200902..4201837 | + | 936 | WP_264359770.1 | cyclase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10853.72 Da Isoelectric Point: 10.7594
>T296628 WP_264359765.1 NZ_OX352322:c4197367-4197086 [Pseudomonas sp. MM223]
MTYKLEFLPSALKEWGKLGHTVREQIKKKLGERLQSPKVQADALRDLANHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRAAQKR
MTYKLEFLPSALKEWGKLGHTVREQIKKKLGERLQSPKVQADALRDLANHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRAAQKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|