Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 3568377..3568966 Replicon chromosome
Accession NZ_OX352322
Organism Pseudomonas sp. MM223

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag ONI07_RS16615 Protein ID WP_264359336.1
Coordinates 3568718..3568966 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag ONI07_RS16610 Protein ID WP_264359335.1
Coordinates 3568377..3568718 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ONI07_RS16575 (DBADOPDK_03388) 3563416..3563727 - 312 WP_140174336.1 transposase family protein -
ONI07_RS16580 (DBADOPDK_03389) 3563730..3563963 - 234 WP_264359329.1 helix-turn-helix domain-containing protein -
ONI07_RS16585 (DBADOPDK_03390) 3564066..3564800 + 735 WP_264359330.1 S24 family peptidase -
ONI07_RS16590 (DBADOPDK_03391) 3564803..3565027 + 225 WP_264359331.1 hypothetical protein -
ONI07_RS16595 (DBADOPDK_03392) 3565024..3565278 + 255 WP_047934733.1 prophage PssSM-02 -
ONI07_RS16600 (DBADOPDK_03393) 3565531..3567276 + 1746 WP_264386986.1 AAA family ATPase -
ONI07_RS16605 (DBADOPDK_03394) 3567358..3568236 + 879 WP_264359334.1 DNA adenine methylase -
ONI07_RS16610 (DBADOPDK_03395) 3568377..3568718 - 342 WP_264359335.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
ONI07_RS16615 (DBADOPDK_03396) 3568718..3568966 - 249 WP_264359336.1 type II toxin-antitoxin system HicA family toxin Toxin
ONI07_RS16620 (DBADOPDK_03397) 3569114..3569371 + 258 WP_264359337.1 DUF1654 domain-containing protein -
ONI07_RS16625 (DBADOPDK_03398) 3569843..3570064 + 222 WP_232894495.1 hypothetical protein -
ONI07_RS16630 (DBADOPDK_03399) 3570128..3570328 + 201 WP_264359338.1 hypothetical protein -
ONI07_RS16635 (DBADOPDK_03400) 3570644..3570934 + 291 WP_264359339.1 hypothetical protein -
ONI07_RS16640 (DBADOPDK_03401) 3570931..3571137 + 207 WP_256824908.1 DUF551 domain-containing protein -
ONI07_RS16645 (DBADOPDK_03402) 3571158..3571481 + 324 WP_256806907.1 hypothetical protein -
ONI07_RS16650 (DBADOPDK_03403) 3571478..3571708 + 231 WP_103462665.1 hypothetical protein -
ONI07_RS16655 3571910..3572047 - 138 WP_158238196.1 hypothetical protein -
ONI07_RS16660 (DBADOPDK_03406) 3572046..3572585 + 540 WP_080604853.1 HNH endonuclease signature motif containing protein -
ONI07_RS16665 (DBADOPDK_03407) 3572640..3573464 + 825 WP_264359340.1 phage recombination protein Bet -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3527646..3588169 60523


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-76)

Antitoxin

Uncharacterised protein family HicB

(55-105)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9128.66 Da        Isoelectric Point: 10.4156

>T296627 WP_264359336.1 NZ_OX352322:c3568966-3568718 [Pseudomonas sp. MM223]
MSKQEKLLAKLLNKQAGFTWPELVTLLGGLGYRQIEGDGSRVKFDNGHPQAMINLHKPHPGNELKAYVKRQVIEHLKAGG
LI

Download         Length: 249 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12418.86 Da        Isoelectric Point: 4.8161

>AT296627 WP_264359335.1 NZ_OX352322:c3568718-3568377 [Pseudomonas sp. MM223]
MSTMLQHRGYYGSIEASPEDNCLFGKLQFIRALVSYEGETVAELTQAFRDAVDDYLDTCASLGQEPEIPCKGSFNVRVGH
DLHLAASVAATQQNISLNDLTRKALSEYLGHHA

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References