Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 806532..807225 | Replicon | chromosome |
Accession | NZ_OX352322 | ||
Organism | Pseudomonas sp. MM223 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | ONI07_RS03680 | Protein ID | WP_003151133.1 |
Coordinates | 806848..807225 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | ONI07_RS03675 | Protein ID | WP_001172026.1 |
Coordinates | 806532..806867 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONI07_RS03645 | 802851..803096 | - | 246 | Protein_697 | DUF4113 domain-containing protein | - |
ONI07_RS03650 | 803330..803785 | + | 456 | WP_023660738.1 | glyoxalase superfamily protein | - |
ONI07_RS03655 (DBADOPDK_00744) | 804058..805337 | - | 1280 | Protein_699 | HD-GYP domain-containing protein | - |
ONI07_RS03660 (DBADOPDK_00745) | 805455..805835 | - | 381 | WP_001054412.1 | hypothetical protein | - |
ONI07_RS03665 (DBADOPDK_00746) | 805832..806158 | - | 327 | WP_000091614.1 | hypothetical protein | - |
ONI07_RS03670 (DBADOPDK_00747) | 806182..806517 | - | 336 | WP_000741275.1 | hypothetical protein | - |
ONI07_RS03675 (DBADOPDK_00748) | 806532..806867 | - | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
ONI07_RS03680 (DBADOPDK_00749) | 806848..807225 | - | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ONI07_RS03685 (DBADOPDK_00750) | 807417..808019 | + | 603 | WP_010465829.1 | recombinase family protein | - |
ONI07_RS03690 (DBADOPDK_00752) | 808003..811033 | + | 3031 | Protein_706 | Tn3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 773552..866795 | 93243 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T296625 WP_003151133.1 NZ_OX352322:c807225-806848 [Pseudomonas sp. MM223]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |