Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2188471..2189124 | Replicon | chromosome |
| Accession | NZ_OX352320 | ||
| Organism | Rheinheimera sp. MM224 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | OM978_RS10335 | Protein ID | WP_264346805.1 |
| Coordinates | 2188471..2188650 (+) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | OM978_RS10340 | Protein ID | WP_264346806.1 |
| Coordinates | 2188705..2189124 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM978_RS10320 (JAMGFMIE_02075) | 2184530..2185945 | + | 1416 | WP_264346802.1 | glucuronate isomerase | - |
| OM978_RS10325 (JAMGFMIE_02076) | 2185957..2187519 | + | 1563 | WP_264346803.1 | mannitol dehydrogenase family protein | - |
| OM978_RS10330 (JAMGFMIE_02077) | 2187516..2188316 | + | 801 | WP_264346804.1 | ThuA domain-containing protein | - |
| OM978_RS10335 (JAMGFMIE_02078) | 2188471..2188650 | + | 180 | WP_264346805.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OM978_RS10340 (JAMGFMIE_02079) | 2188705..2189124 | + | 420 | WP_264346806.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OM978_RS10345 (JAMGFMIE_02080) | 2189230..2190357 | - | 1128 | WP_264346807.1 | alpha/beta hydrolase | - |
| OM978_RS10350 (JAMGFMIE_02081) | 2190376..2190753 | - | 378 | WP_264346808.1 | cyclophilin-like fold protein | - |
| OM978_RS10355 (JAMGFMIE_02082) | 2190863..2192086 | - | 1224 | WP_264346809.1 | MFS transporter | - |
| OM978_RS10360 (JAMGFMIE_02083) | 2192206..2193126 | + | 921 | WP_264346810.1 | LysR family transcriptional regulator | - |
| OM978_RS10365 (JAMGFMIE_02084) | 2193730..2194089 | - | 360 | WP_264346811.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6583.84 Da Isoelectric Point: 11.0850
>T296623 WP_264346805.1 NZ_OX352320:2188471-2188650 [Rheinheimera sp. MM224]
MKSSDLIKELEQAGWVLVRVKGSHHQFKHPLHKLPVTVPHPKKDLGTGLVKAIRKQAGL
MKSSDLIKELEQAGWVLVRVKGSHHQFKHPLHKLPVTVPHPKKDLGTGLVKAIRKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15393.54 Da Isoelectric Point: 4.6384
>AT296623 WP_264346806.1 NZ_OX352320:2188705-2189124 [Rheinheimera sp. MM224]
MLYPVAIEKGSEHSAFGVVVPDVPGCFSAGDTFEEALINAKEALELHLQGLAEMEELPPLASSIDHHFASPEFNGWVWAL
VDIDIEPYMGKASKINVTLPNLLTKKIDDLVQSNPMYKSRSHFLQVAAAHEFERGMQRT
MLYPVAIEKGSEHSAFGVVVPDVPGCFSAGDTFEEALINAKEALELHLQGLAEMEELPPLASSIDHHFASPEFNGWVWAL
VDIDIEPYMGKASKINVTLPNLLTKKIDDLVQSNPMYKSRSHFLQVAAAHEFERGMQRT
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|