Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 1293548..1294077 Replicon chromosome
Accession NZ_OX352320
Organism Rheinheimera sp. MM224

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag OM978_RS06055 Protein ID WP_264345987.1
Coordinates 1293548..1293841 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag OM978_RS06060 Protein ID WP_264345988.1
Coordinates 1293838..1294077 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OM978_RS06020 (JAMGFMIE_01209) 1288605..1289477 + 873 WP_264345981.1 DUF3014 domain-containing protein -
OM978_RS06025 (JAMGFMIE_01210) 1289477..1290067 + 591 WP_264345982.1 1-acyl-sn-glycerol-3-phosphate acyltransferase -
OM978_RS06035 (JAMGFMIE_01211) 1290333..1292270 + 1938 WP_264345983.1 S9 family peptidase -
OM978_RS06040 (JAMGFMIE_01212) 1292323..1292823 - 501 WP_264345984.1 LURP-one-related family protein -
OM978_RS06045 (JAMGFMIE_01213) 1293102..1293329 + 228 WP_264345985.1 hypothetical protein -
OM978_RS06050 (JAMGFMIE_01214) 1293372..1293551 + 180 WP_264345986.1 hypothetical protein -
OM978_RS06055 (JAMGFMIE_01215) 1293548..1293841 - 294 WP_264345987.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OM978_RS06060 (JAMGFMIE_01216) 1293838..1294077 - 240 WP_264345988.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
OM978_RS06065 (JAMGFMIE_01217) 1294189..1294824 - 636 WP_264345989.1 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE -
OM978_RS06070 (JAMGFMIE_01218) 1294821..1295594 - 774 WP_264345990.1 imidazole glycerol phosphate synthase subunit HisF -
OM978_RS06075 (JAMGFMIE_01219) 1295576..1296313 - 738 WP_264345991.1 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase -
OM978_RS06080 (JAMGFMIE_01220) 1296379..1296981 - 603 WP_264345992.1 imidazole glycerol phosphate synthase subunit HisH -
OM978_RS06085 (JAMGFMIE_01221) 1296981..1298051 - 1071 WP_264345993.1 bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-89)

Antitoxin

Antitoxin ParD

(4-71)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11241.07 Da        Isoelectric Point: 10.2841

>T296622 WP_264345987.1 NZ_OX352320:c1293841-1293548 [Rheinheimera sp. MM224]
MKAFVLSQKAMADLRAIAIFTEQRWGKQQRNLYIKQFDDAFHLLAKTPMAGKTCDYIKQGYRKFPQGSHLIFYKDSGSGQ
IEIVRILHKNVDTEAKF

Download         Length: 294 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8857.81 Da        Isoelectric Point: 4.3557

>AT296622 WP_264345988.1 NZ_OX352320:c1294077-1293838 [Rheinheimera sp. MM224]
MAKNTSISLGEHFDHFIAEQIQTGRYGSASEVVRAGLRMLEDSESKLDTLRRMLLEGEQSGLADYNYETFLAELDESGK

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References