Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 697869..698434 | Replicon | chromosome |
Accession | NZ_OX352320 | ||
Organism | Rheinheimera sp. MM224 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OM978_RS03405 | Protein ID | WP_264345525.1 |
Coordinates | 697869..698153 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OM978_RS03410 | Protein ID | WP_264345526.1 |
Coordinates | 698150..698434 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM978_RS03385 (JAMGFMIE_00681) | 693833..694153 | - | 321 | WP_264345522.1 | divalent-cation tolerance protein CutA | - |
OM978_RS03390 (JAMGFMIE_00682) | 694368..694658 | + | 291 | WP_053423916.1 | co-chaperone GroES | - |
OM978_RS03395 (JAMGFMIE_00683) | 694710..696347 | + | 1638 | WP_264345523.1 | chaperonin GroEL | - |
OM978_RS03400 (JAMGFMIE_00684) | 696741..697622 | - | 882 | WP_264345524.1 | restriction endonuclease | - |
OM978_RS03405 (JAMGFMIE_00685) | 697869..698153 | - | 285 | WP_264345525.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM978_RS03410 (JAMGFMIE_00686) | 698150..698434 | - | 285 | WP_264345526.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OM978_RS03415 (JAMGFMIE_00687) | 698806..700947 | + | 2142 | WP_264346912.1 | catalase/peroxidase HPI | - |
OM978_RS03420 (JAMGFMIE_00688) | 701149..701421 | + | 273 | WP_264345527.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
OM978_RS03425 (JAMGFMIE_00689) | 701418..701711 | + | 294 | WP_264345528.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
OM978_RS03430 (JAMGFMIE_00690) | 701883..703361 | + | 1479 | WP_264345529.1 | glycerol kinase GlpK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | katA | 697869..708366 | 10497 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11056.82 Da Isoelectric Point: 4.8668
>T296621 WP_264345525.1 NZ_OX352320:c698153-697869 [Rheinheimera sp. MM224]
MIYWEEEALNDREKIFEYLYAVNPLAAERTDELIEAKVENLLDHPLMGIQRASVRGRLLIIPEVSMIVSYWIDGSTIRVM
RVLHQKQQFPGLER
MIYWEEEALNDREKIFEYLYAVNPLAAERTDELIEAKVENLLDHPLMGIQRASVRGRLLIIPEVSMIVSYWIDGSTIRVM
RVLHQKQQFPGLER
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|