Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
Location | 548454..549220 | Replicon | chromosome |
Accession | NZ_OX352320 | ||
Organism | Rheinheimera sp. MM224 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | OM978_RS02680 | Protein ID | WP_264346911.1 |
Coordinates | 548723..549220 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | OM978_RS02675 | Protein ID | WP_264345379.1 |
Coordinates | 548454..548726 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM978_RS02645 (JAMGFMIE_00533) | 543678..544232 | - | 555 | WP_264345367.1 | DUF805 domain-containing protein | - |
OM978_RS02650 (JAMGFMIE_00534) | 544355..544729 | - | 375 | WP_264345369.1 | VOC family protein | - |
OM978_RS02655 (JAMGFMIE_00535) | 544756..545190 | - | 435 | WP_264345371.1 | hypothetical protein | - |
OM978_RS02660 (JAMGFMIE_00536) | 545244..545627 | - | 384 | WP_264345373.1 | hypothetical protein | - |
OM978_RS02665 (JAMGFMIE_00537) | 545655..546284 | - | 630 | WP_264345375.1 | glutathione S-transferase | - |
OM978_RS02670 (JAMGFMIE_00538) | 546416..548200 | - | 1785 | WP_264345377.1 | DUF885 domain-containing protein | - |
OM978_RS02675 (JAMGFMIE_00539) | 548454..548726 | + | 273 | WP_264345379.1 | DUF1778 domain-containing protein | Antitoxin |
OM978_RS02680 (JAMGFMIE_00540) | 548723..549220 | + | 498 | WP_264346911.1 | GNAT family N-acetyltransferase | Toxin |
OM978_RS02685 (JAMGFMIE_00541) | 549238..550437 | - | 1200 | WP_264345381.1 | organoarsenical effux MFS transporter ArsJ | - |
OM978_RS02690 (JAMGFMIE_00542) | 550460..551473 | - | 1014 | WP_264345383.1 | ArsJ-associated glyceraldehyde-3-phosphate dehydrogenase | - |
OM978_RS02695 (JAMGFMIE_00543) | 551505..551855 | - | 351 | WP_264345385.1 | metalloregulator ArsR/SmtB family transcription factor | - |
OM978_RS02700 (JAMGFMIE_00544) | 551986..552528 | + | 543 | WP_264345387.1 | PH domain-containing protein | - |
OM978_RS02705 (JAMGFMIE_00545) | 552515..553999 | + | 1485 | WP_264345389.1 | PH domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 18504.25 Da Isoelectric Point: 9.5997
>T296620 WP_264346911.1 NZ_OX352320:548723-549220 [Rheinheimera sp. MM224]
IMQTVLLDKSKHDRNRFNCGIDALNNYLKVMASQQSKKDNTRTFVLEDKANPQHIVGFYTLTMTPIDIQSLPASLQKKHQ
SSTSGGLIARLAVDERYKGQKTGEWMLIDAVKKLLQASDAVGFPIVIVDAKDGAKGFYQKYGFRCFEDSEHKLFITIADV
RASFG
IMQTVLLDKSKHDRNRFNCGIDALNNYLKVMASQQSKKDNTRTFVLEDKANPQHIVGFYTLTMTPIDIQSLPASLQKKHQ
SSTSGGLIARLAVDERYKGQKTGEWMLIDAVKKLLQASDAVGFPIVIVDAKDGAKGFYQKYGFRCFEDSEHKLFITIADV
RASFG
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|