Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 3212972..3213564 | Replicon | chromosome |
Accession | NZ_OX352319 | ||
Organism | Pseudomonas sp. MM227 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | ONG87_RS14505 | Protein ID | WP_264381517.1 |
Coordinates | 3213193..3213564 (+) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | ONG87_RS14500 | Protein ID | WP_192138019.1 |
Coordinates | 3212972..3213199 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONG87_RS14480 (AHFPHNDE_02883) | 3208366..3209538 | + | 1173 | WP_264382864.1 | 2-methylaconitate cis-trans isomerase PrpF | - |
ONG87_RS14485 (AHFPHNDE_02884) | 3209535..3210263 | + | 729 | WP_264381516.1 | transporter substrate-binding domain-containing protein | - |
ONG87_RS14490 (AHFPHNDE_02885) | 3210433..3212076 | + | 1644 | WP_122801094.1 | acetolactate synthase large subunit | - |
ONG87_RS14495 (AHFPHNDE_02886) | 3212235..3212795 | - | 561 | WP_264382865.1 | MFS transporter | - |
ONG87_RS14500 (AHFPHNDE_02887) | 3212972..3213199 | + | 228 | WP_192138019.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
ONG87_RS14505 (AHFPHNDE_02888) | 3213193..3213564 | + | 372 | WP_264381517.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ONG87_RS14510 | 3213788..3213931 | - | 144 | Protein_2843 | transposase | - |
ONG87_RS14515 (AHFPHNDE_02889) | 3213997..3214293 | - | 297 | WP_264381518.1 | DUF1330 domain-containing protein | - |
ONG87_RS14520 | 3214394..3214852 | - | 459 | WP_264381519.1 | cupin domain-containing protein | - |
ONG87_RS14525 (AHFPHNDE_02890) | 3214959..3216359 | - | 1401 | WP_264381520.1 | GntP family permease | - |
ONG87_RS14530 (AHFPHNDE_02891) | 3216444..3217223 | - | 780 | WP_264381521.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3209535..3220481 | 10946 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13860.00 Da Isoelectric Point: 6.2158
>T296619 WP_264381517.1 NZ_OX352319:3213193-3213564 [Pseudomonas sp. MM227]
MVRSLFDTNILIDHLSGRPLAEQVIHAAHRPMISLITYMEVLGGAGDAKEADTLRHWMGQQFEVVPVSLDIAHEAVLLRQ
QRRIELPDAIIWASSRLAGAVLVTRNTKDFPETELDVRVPYHL
MVRSLFDTNILIDHLSGRPLAEQVIHAAHRPMISLITYMEVLGGAGDAKEADTLRHWMGQQFEVVPVSLDIAHEAVLLRQ
QRRIELPDAIIWASSRLAGAVLVTRNTKDFPETELDVRVPYHL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|