296617

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 1276469..1277124 Replicon chromosome
Accession NZ_OX352319
Organism Pseudomonas sp. MM227

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag ONG87_RS05795 Protein ID WP_264382397.1
Coordinates 1276942..1277124 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag ONG87_RS05790 Protein ID WP_264382396.1
Coordinates 1276469..1276891 (-) Length 141 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ONG87_RS05750 (AHFPHNDE_01147) 1272161..1272850 + 690 WP_264382828.1 replication protein P -
ONG87_RS05755 (AHFPHNDE_01148) 1272847..1272975 + 129 WP_264382390.1 hypothetical protein -
ONG87_RS05760 (AHFPHNDE_01149) 1272981..1273286 + 306 WP_264382829.1 DUF1364 domain-containing protein -
ONG87_RS05765 (AHFPHNDE_01150) 1273286..1273606 + 321 WP_264382391.1 hypothetical protein -
ONG87_RS05770 (AHFPHNDE_01151) 1273603..1274034 + 432 WP_264382392.1 VRR-NUC domain-containing protein -
ONG87_RS05775 (AHFPHNDE_01152) 1274031..1275332 + 1302 WP_264382393.1 site-specific integrase -
ONG87_RS05780 (AHFPHNDE_01153) 1275329..1275649 + 321 WP_264382394.1 hypothetical protein -
ONG87_RS05785 (AHFPHNDE_01154) 1275679..1276356 + 678 WP_264382395.1 hypothetical protein -
ONG87_RS05790 (AHFPHNDE_01155) 1276469..1276891 - 423 WP_264382396.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
ONG87_RS05795 (AHFPHNDE_01156) 1276942..1277124 - 183 WP_264382397.1 type II toxin-antitoxin system HicA family toxin Toxin
ONG87_RS05800 (AHFPHNDE_01157) 1277555..1277926 + 372 WP_264382398.1 chemotaxis protein -
ONG87_RS05805 (AHFPHNDE_01158) 1277926..1278264 + 339 WP_264382399.1 hypothetical protein -
ONG87_RS05810 (AHFPHNDE_01159) 1278283..1279008 + 726 WP_264382400.1 hypothetical protein -
ONG87_RS05815 (AHFPHNDE_01160) 1279295..1279822 + 528 WP_264382401.1 terminase small subunit -
ONG87_RS05820 (AHFPHNDE_01161) 1279794..1281701 + 1908 WP_264382402.1 phage terminase large subunit family protein -
ONG87_RS05825 (AHFPHNDE_01162) 1281707..1281916 + 210 WP_264382403.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1258374..1314682 56308


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-58)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6915.10 Da        Isoelectric Point: 10.5498

>T296617 WP_264382397.1 NZ_OX352319:c1277124-1276942 [Pseudomonas sp. MM227]
MSCNEFKRWLLAQGVEISKQRSKHFKIFYNGKQTVLPDHGAKEIGEGLRKTIIKQLGLKD

Download         Length: 183 bp

Antitoxin


Download         Length: 141 a.a.        Molecular weight: 15235.45 Da        Isoelectric Point: 5.6306

>AT296617 WP_264382396.1 NZ_OX352319:c1276891-1276469 [Pseudomonas sp. MM227]
MFSYAIKVHAEAGSFWSSCRDIPEAHSAGDTEEELLANAVEGLELALTIYVDQSRPIPLPSAPVKGERVVHLPTLLAAKV
SLWNAMREANMRKADLARLLQSSQTKVDRLLDFEHSSKIEQVEAALAALGKRLAVSVEAA

Download         Length: 423 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References