Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 417273..417937 | Replicon | chromosome |
Accession | NZ_OX352319 | ||
Organism | Pseudomonas sp. MM227 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | ONG87_RS01870 | Protein ID | WP_192055813.1 |
Coordinates | 417533..417937 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | ONG87_RS01865 | Protein ID | WP_185794949.1 |
Coordinates | 417273..417536 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONG87_RS01840 (AHFPHNDE_00365) | 412408..413265 | + | 858 | WP_185794946.1 | formyltetrahydrofolate deformylase | - |
ONG87_RS01845 (AHFPHNDE_00366) | 413466..414665 | + | 1200 | WP_122480430.1 | formaldehyde dehydrogenase, glutathione-independent | - |
ONG87_RS01850 (AHFPHNDE_00367) | 415009..415581 | + | 573 | WP_122480429.1 | DUF2780 domain-containing protein | - |
ONG87_RS01855 (AHFPHNDE_00368) | 415582..416472 | - | 891 | WP_264382098.1 | acyltransferase | - |
ONG87_RS01860 (AHFPHNDE_00369) | 416616..417119 | + | 504 | WP_122480427.1 | ATP-dependent zinc protease | - |
ONG87_RS01865 (AHFPHNDE_00370) | 417273..417536 | + | 264 | WP_185794949.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
ONG87_RS01870 (AHFPHNDE_00371) | 417533..417937 | + | 405 | WP_192055813.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ONG87_RS01875 (AHFPHNDE_00372) | 417951..418574 | - | 624 | WP_240998857.1 | glutathione S-transferase | - |
ONG87_RS01880 (AHFPHNDE_00373) | 418726..420420 | - | 1695 | WP_264382099.1 | ABC transporter ATP-binding protein | - |
ONG87_RS01885 (AHFPHNDE_00374) | 420750..420932 | - | 183 | WP_264382892.1 | hypothetical protein | - |
ONG87_RS01890 (AHFPHNDE_00375) | 420929..422053 | - | 1125 | WP_185794953.1 | PepSY-associated TM helix domain-containing protein | - |
ONG87_RS01895 (AHFPHNDE_00376) | 422197..422904 | - | 708 | WP_264382100.1 | 3'-5' exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14275.61 Da Isoelectric Point: 7.7481
>T296616 WP_192055813.1 NZ_OX352319:417533-417937 [Pseudomonas sp. MM227]
MKQLMLDTNTVSYLLKGHPAVIKNLSAVPMASVCISSITEAELLYGLAKRPSAQRLAGLVNAFLKTVDILPWGSQAAQAY
GSSRAVGERRGQCLGTLDGLIAAHSLSLGMTLVTSDKAFRLVEGLEVQDWCEVA
MKQLMLDTNTVSYLLKGHPAVIKNLSAVPMASVCISSITEAELLYGLAKRPSAQRLAGLVNAFLKTVDILPWGSQAAQAY
GSSRAVGERRGQCLGTLDGLIAAHSLSLGMTLVTSDKAFRLVEGLEVQDWCEVA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|