Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 219098..219614 | Replicon | chromosome |
Accession | NZ_OX352319 | ||
Organism | Pseudomonas sp. MM227 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | ONG87_RS00960 | Protein ID | WP_192102789.1 |
Coordinates | 219327..219614 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | ONG87_RS00955 | Protein ID | WP_122795873.1 |
Coordinates | 219098..219337 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONG87_RS00935 | 215757..216863 | + | 1107 | Protein_179 | FIST C-terminal domain-containing protein | - |
ONG87_RS00940 | 217284..217778 | + | 495 | WP_244657432.1 | methyl-accepting chemotaxis protein | - |
ONG87_RS00945 (AHFPHNDE_00186) | 217832..218686 | - | 855 | WP_264382051.1 | LysR family transcriptional regulator | - |
ONG87_RS00950 (AHFPHNDE_00187) | 218782..219015 | + | 234 | WP_192056581.1 | DUF1127 domain-containing protein | - |
ONG87_RS00955 (AHFPHNDE_00188) | 219098..219337 | + | 240 | WP_122795873.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
ONG87_RS00960 (AHFPHNDE_00189) | 219327..219614 | + | 288 | WP_192102789.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ONG87_RS00965 (AHFPHNDE_00190) | 219788..220627 | + | 840 | WP_264382052.1 | alpha/beta hydrolase-fold protein | - |
ONG87_RS00970 (AHFPHNDE_00191) | 220727..221224 | + | 498 | WP_122480580.1 | RNA polymerase sigma factor | - |
ONG87_RS00975 (AHFPHNDE_00192) | 221221..222183 | + | 963 | WP_264382053.1 | FecR domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 219098..227139 | 8041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11144.99 Da Isoelectric Point: 10.2588
>T296615 WP_192102789.1 NZ_OX352319:219327-219614 [Pseudomonas sp. MM227]
MTYSLEFDARALKEWHKLGDTVRQQLKKKLVAILLNPRNEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
REREAVYRKAAERLS
MTYSLEFDARALKEWHKLGDTVRQQLKKKLVAILLNPRNEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
REREAVYRKAAERLS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|