Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2839815..2840344 | Replicon | chromosome |
| Accession | NZ_OX344719 | ||
| Organism | Staphylococcus aureus strain ST20190863 isolate ST20190863 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | OOL12_RS14320 | Protein ID | WP_000621175.1 |
| Coordinates | 2839982..2840344 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | OOL12_RS14315 | Protein ID | WP_000948331.1 |
| Coordinates | 2839815..2839985 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOL12_RS14285 (2834852) | 2834852..2835412 | + | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
| OOL12_RS14290 (2835620) | 2835620..2836099 | + | 480 | WP_001287088.1 | hypothetical protein | - |
| OOL12_RS14295 (2836092) | 2836092..2837675 | + | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| OOL12_RS14300 (2837662) | 2837662..2838153 | + | 492 | WP_001205910.1 | PH domain-containing protein | - |
| OOL12_RS14305 (2838157) | 2838157..2838516 | + | 360 | WP_000581200.1 | holo-ACP synthase | - |
| OOL12_RS14310 (2838582) | 2838582..2839730 | + | 1149 | WP_001281145.1 | alanine racemase | - |
| OOL12_RS14315 (2839815) | 2839815..2839985 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| OOL12_RS14320 (2839982) | 2839982..2840344 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OOL12_RS14325 (2840694) | 2840694..2841695 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| OOL12_RS14330 (2841814) | 2841814..2842140 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| OOL12_RS14335 (2842142) | 2842142..2842621 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| OOL12_RS14340 (2842596) | 2842596..2843366 | + | 771 | WP_001041103.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T296612 WP_000621175.1 NZ_OX344719:2839982-2840344 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|