Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1294860..1295337 Replicon chromosome
Accession NZ_OX344719
Organism Staphylococcus aureus strain ST20190863 isolate ST20190863

Toxin (Protein)


Gene name TsaT Uniprot ID Q2G005
Locus tag OOL12_RS06690 Protein ID WP_000052078.1
Coordinates 1295149..1295337 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag OOL12_RS06685 Protein ID WP_001059690.1
Coordinates 1294860..1295120 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OOL12_RS06650 (1290253) 1290253..1290969 - 717 WP_000150017.1 type I 3-dehydroquinate dehydratase -
OOL12_RS06655 (1291117) 1291117..1291539 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
OOL12_RS06660 (1291938) 1291938..1292432 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
OOL12_RS06665 (1292587) 1292587..1293204 + 618 WP_000255561.1 LysE/ArgO family amino acid transporter -
OOL12_RS06670 (1293277) 1293277..1293858 - 582 WP_001140686.1 histidine phosphatase family protein -
OOL12_RS06675 (1294083) 1294083..1294319 + 237 WP_000368687.1 hypothetical protein -
OOL12_RS06680 (1294316) 1294316..1294519 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
OOL12_RS06685 (1294860) 1294860..1295120 + 261 WP_001059690.1 hypothetical protein Antitoxin
OOL12_RS06690 (1295149) 1295149..1295337 + 189 WP_000052078.1 hypothetical protein Toxin
OOL12_RS06695 (1295525) 1295525..1296094 + 570 WP_001106654.1 lipoprotein N-acylation protein LnsA -
OOL12_RS06700 (1296182) 1296182..1296466 + 285 WP_001004395.1 hypothetical protein -
OOL12_RS06705 (1296528) 1296528..1296746 + 219 WP_000005886.1 hypothetical protein -
OOL12_RS06710 (1297242) 1297242..1297442 - 201 WP_001059082.1 cold-shock protein -
OOL12_RS06715 (1297799) 1297799..1298485 - 687 WP_001548082.1 thermonuclease family protein -
OOL12_RS06720 (1298826) 1298826..1299296 - 471 WP_000824472.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7172.84 Da        Isoelectric Point: 9.9971

>T296604 WP_000052078.1 NZ_OX344719:1295149-1295337 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTSKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT296604 WP_001059690.1 NZ_OX344719:1294860-1295120 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D6HZ40

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References