Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 54868..55604 Replicon plasmid 2
Accession NZ_OX337253
Organism Klebsiella pneumoniae isolate 65326252-51f1-11ec-980a-fa163eea3084

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag OGZ45_RS26510 Protein ID WP_003026803.1
Coordinates 55122..55604 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag OGZ45_RS26505 Protein ID WP_003026799.1
Coordinates 54868..55134 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGZ45_RS26460 50930..51292 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
OGZ45_RS26465 51342..51692 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
OGZ45_RS26470 52050..52319 + 270 WP_004152102.1 hypothetical protein -
OGZ45_RS26475 52307..52882 + 576 WP_004152103.1 hypothetical protein -
OGZ45_RS26480 52913..53407 + 495 WP_004152104.1 DNA-binding protein -
OGZ45_RS26485 53451..53819 + 369 WP_004152105.1 hypothetical protein -
OGZ45_RS26490 53853..54056 + 204 WP_004152106.1 HHA domain-containing protein -
OGZ45_RS26495 54105..54362 + 258 WP_004152107.1 hypothetical protein -
OGZ45_RS26500 54438..54692 + 255 WP_004152108.1 hypothetical protein -
OGZ45_RS26505 54868..55134 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
OGZ45_RS26510 55122..55604 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
OGZ45_RS26515 55812..57158 + 1347 WP_077253535.1 ISNCY family transposase -
OGZ45_RS26520 57207..57602 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
OGZ45_RS26525 57750..58915 - 1166 Protein_60 IS3 family transposase -
OGZ45_RS26530 59092..60054 - 963 WP_004152113.1 zinc metalloprotease HtpX -
OGZ45_RS26535 60041..60529 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr / qnrB1 / dfrA14 - 1..240519 240519


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T296596 WP_003026803.1 NZ_OX337253:55122-55604 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT296596 WP_003026799.1 NZ_OX337253:54868-55134 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References