Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4842560..4843076 | Replicon | chromosome |
Accession | NZ_OX337252 | ||
Organism | Klebsiella pneumoniae isolate 65326252-51f1-11ec-980a-fa163eea3084 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | OGZ45_RS23535 | Protein ID | WP_004178374.1 |
Coordinates | 4842560..4842844 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OGZ45_RS23540 | Protein ID | WP_002886901.1 |
Coordinates | 4842834..4843076 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGZ45_RS23510 | 4837977..4838285 | - | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
OGZ45_RS23515 | 4838370..4838543 | + | 174 | WP_032408826.1 | hypothetical protein | - |
OGZ45_RS23520 | 4838546..4839289 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OGZ45_RS23525 | 4839646..4841784 | + | 2139 | WP_087834662.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OGZ45_RS23530 | 4842092..4842556 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OGZ45_RS23535 | 4842560..4842844 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OGZ45_RS23540 | 4842834..4843076 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OGZ45_RS23545 | 4843154..4845064 | - | 1911 | WP_040225314.1 | PRD domain-containing protein | - |
OGZ45_RS23550 | 4845087..4846241 | - | 1155 | WP_049000495.1 | lactonase family protein | - |
OGZ45_RS23555 | 4846308..4847048 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T296593 WP_004178374.1 NZ_OX337252:c4842844-4842560 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |