Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 2323536..2324165 | Replicon | chromosome |
Accession | NZ_OX336253 | ||
Organism | Neisseria sp. Marseille-Q5346 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | OGY80_RS11360 | Protein ID | WP_009174526.1 |
Coordinates | 2323989..2324165 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OGY80_RS11355 | Protein ID | WP_107842571.1 |
Coordinates | 2323536..2323952 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGY80_RS11340 | 2318622..2319059 | - | 438 | WP_003757627.1 | hypothetical protein | - |
OGY80_RS11345 | 2319177..2319818 | - | 642 | WP_003757630.1 | S24 family peptidase | - |
OGY80_RS11350 | 2320274..2323114 | + | 2841 | WP_263341725.1 | DUF5906 domain-containing protein | - |
OGY80_RS11355 | 2323536..2323952 | - | 417 | WP_107842571.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OGY80_RS11360 | 2323989..2324165 | - | 177 | WP_009174526.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OGY80_RS11365 | 2324312..2325064 | - | 753 | WP_263341732.1 | hypothetical protein | - |
OGY80_RS11370 | 2325393..2326358 | + | 966 | WP_263341734.1 | Bro-N domain-containing protein | - |
OGY80_RS11375 | 2326491..2326895 | + | 405 | WP_263341736.1 | molecular chaperone DnaJ | - |
OGY80_RS11380 | 2327182..2327844 | + | 663 | WP_263341738.1 | hypothetical protein | - |
OGY80_RS11385 | 2328124..2328564 | - | 441 | WP_049322359.1 | phage virion morphogenesis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2312304..2352714 | 40410 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6719.96 Da Isoelectric Point: 10.7708
>T296582 WP_009174526.1 NZ_OX336253:c2324165-2323989 [Neisseria sp. Marseille-Q5346]
MKQSEFLKWLMAQGVETKDGTRHIKLYYKGKQSHLPRHPSKELKTGLVEGIKKQLGLK
MKQSEFLKWLMAQGVETKDGTRHIKLYYKGKQSHLPRHPSKELKTGLVEGIKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15421.57 Da Isoelectric Point: 4.3191
>AT296582 WP_107842571.1 NZ_OX336253:c2323952-2323536 [Neisseria sp. Marseille-Q5346]
MYYPAKFTPAEEGGYVVTFRDIPEAITQGDDMTEAVEMAEDVLQSAMDFYFEDQRPAPLPSAPEEGERLVALPLSVYSKV
LLLNEMLAQDVSKSELARRLETTPQEVQRITGLHHATKIDTVVRALAQLGKQLEIRLA
MYYPAKFTPAEEGGYVVTFRDIPEAITQGDDMTEAVEMAEDVLQSAMDFYFEDQRPAPLPSAPEEGERLVALPLSVYSKV
LLLNEMLAQDVSKSELARRLETTPQEVQRITGLHHATKIDTVVRALAQLGKQLEIRLA
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|