Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 6306040..6306641 | Replicon | chromosome |
Accession | NZ_OX216966 | ||
Organism | Paenibacillus dendritiformis isolate ena-SAMPLE-TAB-03-06-2022-11:19:07:959-6672 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | H3SFP1 |
Locus tag | NNL35_RS28340 | Protein ID | WP_006676846.1 |
Coordinates | 6306040..6306375 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | NNL35_RS28345 | Protein ID | WP_238535330.1 |
Coordinates | 6306372..6306641 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNL35_RS28325 (H7S4_005666) | 6301855..6303147 | - | 1293 | WP_202947080.1 | citrate transporter | - |
NNL35_RS28330 (H7S4_005667) | 6303194..6304552 | - | 1359 | WP_006676848.1 | FAD-dependent oxidoreductase | - |
NNL35_RS28335 (H7S4_005668) | 6304771..6305448 | - | 678 | WP_006676847.1 | N-acetylmuramoyl-L-alanine amidase | - |
NNL35_RS28340 (H7S4_005669) | 6306040..6306375 | - | 336 | WP_006676846.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NNL35_RS28345 (H7S4_005670) | 6306372..6306641 | - | 270 | WP_238535330.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NNL35_RS28350 (H7S4_005671) | 6307129..6308619 | + | 1491 | WP_006676844.1 | peptide MFS transporter | - |
NNL35_RS28355 (H7S4_005672) | 6309297..6311351 | + | 2055 | WP_006676843.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12237.12 Da Isoelectric Point: 5.8184
>T296574 WP_006676846.1 NZ_OX216966:c6306375-6306040 [Paenibacillus dendritiformis]
MTVPGRGDLVWLNFDAQAGYEQAGRRPAIVLSEADFNEVTGFAVVCPITSQVTNYPFEVPLPEGFPFTGVVLTDQLKSLD
VKNRRMKIVANIHVESECMKAVLRNARSILA
MTVPGRGDLVWLNFDAQAGYEQAGRRPAIVLSEADFNEVTGFAVVCPITSQVTNYPFEVPLPEGFPFTGVVLTDQLKSLD
VKNRRMKIVANIHVESECMKAVLRNARSILA
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|