Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
Location | 6211716..6212351 | Replicon | chromosome |
Accession | NZ_OX216966 | ||
Organism | Paenibacillus dendritiformis isolate ena-SAMPLE-TAB-03-06-2022-11:19:07:959-6672 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | H3SI32 |
Locus tag | NNL35_RS27920 | Protein ID | WP_006677694.1 |
Coordinates | 6211716..6212066 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2W4HCL7 |
Locus tag | NNL35_RS27925 | Protein ID | WP_040731899.1 |
Coordinates | 6212070..6212351 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNL35_RS27915 (H7S4_005584) | 6208510..6210981 | + | 2472 | WP_006677695.1 | M60 family metallopeptidase | - |
NNL35_RS27920 (H7S4_005585) | 6211716..6212066 | - | 351 | WP_006677694.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NNL35_RS27925 (H7S4_005586) | 6212070..6212351 | - | 282 | WP_040731899.1 | CopG family ribbon-helix-helix protein | Antitoxin |
NNL35_RS27930 (H7S4_005587) | 6212559..6213794 | - | 1236 | WP_006677692.1 | alanine racemase | - |
NNL35_RS27935 (H7S4_005588) | 6214036..6215154 | - | 1119 | WP_006677691.1 | DUF4367 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12843.83 Da Isoelectric Point: 5.5664
>T296573 WP_006677694.1 NZ_OX216966:c6212066-6211716 [Paenibacillus dendritiformis]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMHKVDDGLLISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTHGFDRDSVILLEQI
RTIDKQRLTDKITHLDEETMHKVDDGLLISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | H3SI32 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W4HCL7 |