Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-UPF0150 |
| Location | 5302833..5303465 | Replicon | chromosome |
| Accession | NZ_OX216966 | ||
| Organism | Paenibacillus dendritiformis isolate ena-SAMPLE-TAB-03-06-2022-11:19:07:959-6672 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | H3SM07 |
| Locus tag | NNL35_RS23780 | Protein ID | WP_006679082.1 |
| Coordinates | 5302833..5303021 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | H3SM08 |
| Locus tag | NNL35_RS23785 | Protein ID | WP_006679083.1 |
| Coordinates | 5303052..5303465 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNL35_RS23745 (H7S4_004751) | 5297965..5298375 | - | 411 | WP_006679601.1 | DUF4064 domain-containing protein | - |
| NNL35_RS23750 (H7S4_004752) | 5299095..5299667 | - | 573 | WP_006679077.1 | TetR/AcrR family transcriptional regulator | - |
| NNL35_RS23755 (H7S4_004753) | 5299770..5300612 | - | 843 | WP_040733840.1 | aminoglycoside phosphotransferase family protein | - |
| NNL35_RS23760 (H7S4_004754) | 5300658..5301041 | - | 384 | WP_006679079.1 | retropepsin-like aspartic protease | - |
| NNL35_RS23765 (H7S4_004755) | 5301038..5301262 | - | 225 | WP_083835618.1 | hypothetical protein | - |
| NNL35_RS23770 (H7S4_004756) | 5301358..5301990 | - | 633 | WP_006679080.1 | DUF2185 domain-containing protein | - |
| NNL35_RS23775 (H7S4_004757) | 5302079..5302330 | - | 252 | WP_006679081.1 | hypothetical protein | - |
| NNL35_RS23780 (H7S4_004758) | 5302833..5303021 | + | 189 | WP_006679082.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NNL35_RS23785 (H7S4_004759) | 5303052..5303465 | + | 414 | WP_006679083.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NNL35_RS23790 (H7S4_004760) | 5303778..5304143 | + | 366 | WP_006679084.1 | SH3 domain-containing protein | - |
| NNL35_RS23795 (H7S4_004761) | 5304229..5304792 | - | 564 | WP_238535438.1 | sigma-70 family RNA polymerase sigma factor | - |
| NNL35_RS23800 (H7S4_004762) | 5305009..5305686 | - | 678 | WP_006679086.1 | PAS domain-containing protein | - |
| NNL35_RS23805 (H7S4_004763) | 5306098..5307141 | + | 1044 | WP_006679087.1 | PTS sugar transporter subunit IIC | - |
| NNL35_RS23810 (H7S4_004764) | 5307201..5307908 | + | 708 | WP_006679088.1 | L-serine ammonia-lyase, iron-sulfur-dependent subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 5282242..5304792 | 22550 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7255.51 Da Isoelectric Point: 11.0973
>T296572 WP_006679082.1 NZ_OX216966:5302833-5303021 [Paenibacillus dendritiformis]
MIKRTHQEKLILKSDGWVHKNTEGDHYHFVHPTKKGKVSVPHPKKDIKRRTTKSIFKQAGLI
MIKRTHQEKLILKSDGWVHKNTEGDHYHFVHPTKKGKVSVPHPKKDIKRRTTKSIFKQAGLI
Download Length: 189 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15284.15 Da Isoelectric Point: 4.2119
>AT296572 WP_006679083.1 NZ_OX216966:5303052-5303465 [Paenibacillus dendritiformis]
MSKYIYPAVFHPGEPDEGGYTVTFPDLPGCISEGDTLDEALHMAKDALGGHLYLMEEDKDDIPQPTKPNAIQLEDDEFVS
LIQVSTDFVRERIRNKAINKTLTIPKWLNDAAAEEGINFSQTLQDALKEKLGVKDFS
MSKYIYPAVFHPGEPDEGGYTVTFPDLPGCISEGDTLDEALHMAKDALGGHLYLMEEDKDDIPQPTKPNAIQLEDDEFVS
LIQVSTDFVRERIRNKAINKTLTIPKWLNDAAAEEGINFSQTLQDALKEKLGVKDFS
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|