Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 106706..107307 | Replicon | plasmid P1 |
| Accession | NZ_OX030729 | ||
| Organism | Escherichia coli isolate 68 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | LQ200_RS25890 | Protein ID | WP_001216034.1 |
| Coordinates | 106927..107307 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | LQ200_RS25885 | Protein ID | WP_001190712.1 |
| Coordinates | 106706..106927 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ200_RS25875 (103699) | 103699..104970 | - | 1272 | WP_048266692.1 | restriction endonuclease subunit S | - |
| LQ200_RS25880 (104967) | 104967..106523 | - | 1557 | WP_001553856.1 | type I restriction-modification system subunit M | - |
| LQ200_RS25885 (106706) | 106706..106927 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| LQ200_RS25890 (106927) | 106927..107307 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| LQ200_RS25895 (107312) | 107312..107491 | + | 180 | WP_001513661.1 | hypothetical protein | - |
| LQ200_RS25900 (107519) | 107519..107797 | + | 279 | Protein_125 | pdcB | - |
| LQ200_RS25905 (107802) | 107802..108215 | + | 414 | Protein_126 | integrase core domain-containing protein | - |
| LQ200_RS25910 (108165) | 108165..108500 | - | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
| LQ200_RS25915 (108710) | 108710..109690 | - | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
| LQ200_RS25920 (109934) | 109934..111337 | + | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
| LQ200_RS25925 (111324) | 111324..112256 | + | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aac(3)-IId / erm(B) / mph(A) / sul1 / qacE / aadA5 / aac(6')-Ib-cr / blaOXA-1 / catB3 / blaTEM-1B | - | 1..115409 | 115409 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T296568 WP_001216034.1 NZ_OX030729:106927-107307 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |