Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 106706..107307 Replicon plasmid P1
Accession NZ_OX030729
Organism Escherichia coli isolate 68

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag LQ200_RS25890 Protein ID WP_001216034.1
Coordinates 106927..107307 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag LQ200_RS25885 Protein ID WP_001190712.1
Coordinates 106706..106927 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ200_RS25875 (103699) 103699..104970 - 1272 WP_048266692.1 restriction endonuclease subunit S -
LQ200_RS25880 (104967) 104967..106523 - 1557 WP_001553856.1 type I restriction-modification system subunit M -
LQ200_RS25885 (106706) 106706..106927 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LQ200_RS25890 (106927) 106927..107307 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
LQ200_RS25895 (107312) 107312..107491 + 180 WP_001513661.1 hypothetical protein -
LQ200_RS25900 (107519) 107519..107797 + 279 Protein_125 pdcB -
LQ200_RS25905 (107802) 107802..108215 + 414 Protein_126 integrase core domain-containing protein -
LQ200_RS25910 (108165) 108165..108500 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
LQ200_RS25915 (108710) 108710..109690 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
LQ200_RS25920 (109934) 109934..111337 + 1404 WP_001373486.1 S-methylmethionine permease -
LQ200_RS25925 (111324) 111324..112256 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(3)-IId / erm(B) / mph(A) / sul1 / qacE / aadA5 / aac(6')-Ib-cr / blaOXA-1 / catB3 / blaTEM-1B - 1..115409 115409


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T296568 WP_001216034.1 NZ_OX030729:106927-107307 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT296568 WP_001190712.1 NZ_OX030729:106706-106927 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References