Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 94074..94717 | Replicon | plasmid P1 |
Accession | NZ_OX030729 | ||
Organism | Escherichia coli isolate 68 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | LQ200_RS25845 | Protein ID | WP_001044768.1 |
Coordinates | 94301..94717 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | LQ200_RS25840 | Protein ID | WP_001261287.1 |
Coordinates | 94074..94304 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ200_RS25825 (89312) | 89312..90949 | - | 1638 | WP_223201785.1 | hypothetical protein | - |
LQ200_RS25830 (91292) | 91292..92520 | + | 1229 | WP_088895425.1 | IS3-like element IS2 family transposase | - |
LQ200_RS25835 (92445) | 92445..93767 | - | 1323 | WP_230139594.1 | hypothetical protein | - |
LQ200_RS25840 (94074) | 94074..94304 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LQ200_RS25845 (94301) | 94301..94717 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ200_RS25850 (94879) | 94879..97017 | - | 2139 | WP_000350635.1 | AAA family ATPase | - |
LQ200_RS25855 (97482) | 97482..98477 | + | 996 | WP_000246636.1 | hypothetical protein | - |
LQ200_RS25860 (98520) | 98520..99413 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aac(3)-IId / erm(B) / mph(A) / sul1 / qacE / aadA5 / aac(6')-Ib-cr / blaOXA-1 / catB3 / blaTEM-1B | - | 1..115409 | 115409 | |
- | flank | IS/Tn | - | - | 99550..100053 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T296567 WP_001044768.1 NZ_OX030729:94301-94717 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |