Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 86259..86784 | Replicon | plasmid P1 |
Accession | NZ_OX030729 | ||
Organism | Escherichia coli isolate 68 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | LQ200_RS25800 | Protein ID | WP_001159868.1 |
Coordinates | 86259..86564 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | LQ200_RS25805 | Protein ID | WP_000813634.1 |
Coordinates | 86566..86784 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ200_RS25785 (82169) | 82169..83335 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
LQ200_RS25790 (83923) | 83923..84678 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
LQ200_RS25795 (85452) | 85452..86258 | - | 807 | WP_000016982.1 | site-specific integrase | - |
LQ200_RS25800 (86259) | 86259..86564 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
LQ200_RS25805 (86566) | 86566..86784 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
LQ200_RS25810 (87418) | 87418..87615 | + | 198 | WP_000215657.1 | hypothetical protein | - |
LQ200_RS25815 (87612) | 87612..87896 | - | 285 | WP_000642771.1 | hypothetical protein | - |
LQ200_RS25820 (87916) | 87916..89049 | - | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
LQ200_RS25825 (89312) | 89312..90949 | - | 1638 | WP_223201785.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aac(3)-IId / erm(B) / mph(A) / sul1 / qacE / aadA5 / aac(6')-Ib-cr / blaOXA-1 / catB3 / blaTEM-1B | - | 1..115409 | 115409 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T296566 WP_001159868.1 NZ_OX030729:c86564-86259 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|