Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 5209966..5210671 | Replicon | chromosome |
Accession | NZ_OX030728 | ||
Organism | Escherichia coli isolate 68 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | LQ200_RS24885 | Protein ID | WP_000539521.1 |
Coordinates | 5210285..5210671 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | LQ200_RS24880 | Protein ID | WP_001280945.1 |
Coordinates | 5209966..5210295 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ200_RS24865 (5205123) | 5205123..5206034 | + | 912 | WP_001236018.1 | glutathione ABC transporter permease GsiD | - |
LQ200_RS24870 (5206212) | 5206212..5208560 | + | 2349 | WP_001328220.1 | EAL domain-containing protein | - |
LQ200_RS24875 (5208568) | 5208568..5209896 | + | 1329 | WP_000086868.1 | GGDEF domain-containing protein | - |
LQ200_RS24880 (5209966) | 5209966..5210295 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
LQ200_RS24885 (5210285) | 5210285..5210671 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ200_RS24890 (5210897) | 5210897..5212222 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
LQ200_RS24895 (5212435) | 5212435..5212818 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
LQ200_RS24900 (5212929) | 5212929..5214044 | + | 1116 | WP_000555049.1 | aldose sugar dehydrogenase YliI | - |
LQ200_RS24905 (5214041) | 5214041..5214667 | - | 627 | WP_001328219.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T296561 WP_000539521.1 NZ_OX030728:c5210671-5210285 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|