Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4786322..4786940 | Replicon | chromosome |
Accession | NZ_OX030728 | ||
Organism | Escherichia coli isolate 68 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | LQ200_RS23025 | Protein ID | WP_001291435.1 |
Coordinates | 4786322..4786540 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | LQ200_RS23030 | Protein ID | WP_000344800.1 |
Coordinates | 4786566..4786940 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ200_RS22990 (4781611) | 4781611..4782183 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
LQ200_RS22995 (4782214) | 4782214..4782525 | - | 312 | WP_000409905.1 | MGMT family protein | - |
LQ200_RS23005 (4782904) | 4782904..4783257 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
LQ200_RS23010 (4783299) | 4783299..4784849 | - | 1551 | WP_001445674.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
LQ200_RS23015 (4785013) | 4785013..4785483 | - | 471 | WP_001328420.1 | YlaC family protein | - |
LQ200_RS23020 (4785599) | 4785599..4786150 | - | 552 | WP_000102573.1 | maltose O-acetyltransferase | - |
LQ200_RS23025 (4786322) | 4786322..4786540 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
LQ200_RS23030 (4786566) | 4786566..4786940 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
LQ200_RS23035 (4787486) | 4787486..4790635 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
LQ200_RS23040 (4790658) | 4790658..4791851 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T296560 WP_001291435.1 NZ_OX030728:c4786540-4786322 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT296560 WP_000344800.1 NZ_OX030728:c4786940-4786566 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |