Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4067726..4068561 | Replicon | chromosome |
| Accession | NZ_OX030728 | ||
| Organism | Escherichia coli isolate 68 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q1R2L4 |
| Locus tag | LQ200_RS19565 | Protein ID | WP_001094426.1 |
| Coordinates | 4068184..4068561 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | Q1R2L5 |
| Locus tag | LQ200_RS19560 | Protein ID | WP_001285575.1 |
| Coordinates | 4067726..4068094 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ200_RS19525 (4063617) | 4063617..4064297 | + | 681 | WP_181261079.1 | WYL domain-containing protein | - |
| LQ200_RS19530 (4064445) | 4064445..4065122 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| LQ200_RS19535 (4065128) | 4065128..4065361 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
| LQ200_RS19540 (4065451) | 4065451..4066269 | + | 819 | WP_170881551.1 | DUF932 domain-containing protein | - |
| LQ200_RS19545 (4066361) | 4066361..4066846 | + | 486 | WP_000206664.1 | antirestriction protein | - |
| LQ200_RS19550 (4066862) | 4066862..4067338 | + | 477 | WP_001186725.1 | RadC family protein | - |
| LQ200_RS19555 (4067425) | 4067425..4067646 | + | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| LQ200_RS19560 (4067726) | 4067726..4068094 | + | 369 | WP_001285575.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ200_RS19565 (4068184) | 4068184..4068561 | + | 378 | WP_001094426.1 | TA system toxin CbtA family protein | Toxin |
| LQ200_RS19570 (4068558) | 4068558..4069046 | + | 489 | WP_096950893.1 | DUF5983 family protein | - |
| LQ200_RS19575 (4069058) | 4069058..4069255 | + | 198 | WP_000839272.1 | DUF957 domain-containing protein | - |
| LQ200_RS19580 (4069340) | 4069340..4069489 | + | 150 | Protein_3826 | hypothetical protein | - |
| LQ200_RS19585 (4069956) | 4069956..4071223 | + | 1268 | Protein_3827 | integrase arm-type DNA-binding domain-containing protein | - |
| LQ200_RS19590 (4071795) | 4071795..4072412 | + | 618 | WP_000611142.1 | DUF1819 family protein | - |
| LQ200_RS19595 (4072409) | 4072409..4073011 | + | 603 | WP_000999546.1 | DUF1788 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14072.99 Da Isoelectric Point: 7.3523
>T296554 WP_001094426.1 NZ_OX030728:4068184-4068561 [Escherichia coli]
MNTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13709.52 Da Isoelectric Point: 6.6258
>AT296554 WP_001285575.1 NZ_OX030728:4067726-4068094 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454ABD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454ABF5 |