Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 3975677..3976272 | Replicon | chromosome |
Accession | NZ_OX030728 | ||
Organism | Escherichia coli isolate 68 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | LQ200_RS19140 | Protein ID | WP_000239581.1 |
Coordinates | 3975922..3976272 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | V0YZQ7 |
Locus tag | LQ200_RS19135 | Protein ID | WP_001223206.1 |
Coordinates | 3975677..3975928 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ200_RS19125 (3971342) | 3971342..3975121 | + | 3780 | WP_000060869.1 | autotransporter assembly complex protein TamB | - |
LQ200_RS19130 (3975124) | 3975124..3975465 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
LQ200_RS19135 (3975677) | 3975677..3975928 | + | 252 | WP_001223206.1 | type II toxin-antitoxin system ChpS family antitoxin | Antitoxin |
LQ200_RS19140 (3975922) | 3975922..3976272 | + | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
LQ200_RS19145 (3976351) | 3976351..3976881 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
LQ200_RS19150 (3977191) | 3977191..3978147 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
LQ200_RS19155 (3978289) | 3978289..3979791 | + | 1503 | WP_001095668.1 | sugar ABC transporter ATP-binding protein | - |
LQ200_RS19160 (3979805) | 3979805..3980827 | + | 1023 | WP_024176215.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T296553 WP_000239581.1 NZ_OX030728:3975922-3976272 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|