Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2511965..2512799 Replicon chromosome
Accession NZ_OX030728
Organism Escherichia coli isolate 68

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0H2VDB0
Locus tag LQ200_RS12260 Protein ID WP_000854688.1
Coordinates 2512422..2512799 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0H2VAY1
Locus tag LQ200_RS12255 Protein ID WP_001285596.1
Coordinates 2511965..2512345 (+) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ200_RS12220 (2508250) 2508250..2508705 + 456 WP_000581502.1 IrmA family protein -
LQ200_RS12225 (2508784) 2508784..2509017 + 234 WP_001119727.1 DUF905 family protein -
LQ200_RS12230 (2509118) 2509118..2509936 + 819 WP_001234616.1 DUF932 domain-containing protein -
LQ200_RS12235 (2509991) 2509991..2510476 + 486 WP_000849564.1 antirestriction protein -
LQ200_RS12240 (2510492) 2510492..2510968 + 477 WP_001186726.1 RadC family protein -
LQ200_RS12245 (2511031) 2511031..2511252 + 222 WP_000692329.1 DUF987 domain-containing protein -
LQ200_RS12250 (2511271) 2511271..2511915 + 645 WP_000094917.1 hypothetical protein -
LQ200_RS12255 (2511965) 2511965..2512345 + 381 WP_001285596.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ200_RS12260 (2512422) 2512422..2512799 + 378 WP_000854688.1 TA system toxin CbtA family protein Toxin
LQ200_RS12265 (2512796) 2512796..2513284 + 489 WP_181261118.1 DUF5983 family protein -
LQ200_RS12270 (2513301) 2513301..2513498 + 198 WP_000839260.1 DUF957 domain-containing protein -
LQ200_RS12275 (2513712) 2513712..2514731 + 1020 WP_000875213.1 IS110 family transposase -
LQ200_RS12280 (2515015) 2515015..2515860 + 846 WP_001280441.1 DUF4942 domain-containing protein -
LQ200_RS12285 (2515929) 2515929..2516324 + 396 WP_000208383.1 DUF6088 family protein -
LQ200_RS12290 (2516317) 2516317..2517251 + 935 Protein_2415 nucleotidyl transferase AbiEii/AbiGii toxin family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / kpsT / kpsM / gspM 2511965..2537559 25594
- flank IS/Tn - - 2513712..2514731 1019


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14014.01 Da        Isoelectric Point: 8.5221

>T296550 WP_000854688.1 NZ_OX030728:2512422-2512799 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13897.70 Da        Isoelectric Point: 4.7959

>AT296550 WP_001285596.1 NZ_OX030728:2511965-2512345 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCAVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2VDB0

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2VAY1

References