Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2340089..2340743 | Replicon | chromosome |
| Accession | NZ_OX030728 | ||
| Organism | Escherichia coli isolate 68 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | LQ200_RS11370 | Protein ID | WP_000244781.1 |
| Coordinates | 2340089..2340496 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | LQ200_RS11375 | Protein ID | WP_000354046.1 |
| Coordinates | 2340477..2340743 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ200_RS11350 (2336046) | 2336046..2337779 | - | 1734 | WP_000813226.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| LQ200_RS11355 (2337785) | 2337785..2338495 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ200_RS11360 (2338520) | 2338520..2339416 | - | 897 | WP_000806652.1 | site-specific tyrosine recombinase XerD | - |
| LQ200_RS11365 (2339528) | 2339528..2340049 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| LQ200_RS11370 (2340089) | 2340089..2340496 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| LQ200_RS11375 (2340477) | 2340477..2340743 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| LQ200_RS11380 (2340986) | 2340986..2341966 | + | 981 | WP_000886086.1 | tRNA-modifying protein YgfZ | - |
| LQ200_RS11385 (2342043) | 2342043..2342702 | - | 660 | WP_000250269.1 | hemolysin III family protein | - |
| LQ200_RS11390 (2342866) | 2342866..2343177 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| LQ200_RS11395 (2343222) | 2343222..2344655 | + | 1434 | WP_001559758.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T296549 WP_000244781.1 NZ_OX030728:c2340496-2340089 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|