Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 604320..604958 | Replicon | chromosome |
| Accession | NZ_OX030728 | ||
| Organism | Escherichia coli isolate 68 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B7N4J4 |
| Locus tag | LQ200_RS03045 | Protein ID | WP_000813797.1 |
| Coordinates | 604320..604496 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LQ200_RS03050 | Protein ID | WP_001270286.1 |
| Coordinates | 604542..604958 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ200_RS03025 (599942) | 599942..601114 | - | 1173 | WP_001236217.1 | BenE family transporter YdcO | - |
| LQ200_RS03030 (601206) | 601206..601742 | + | 537 | WP_000429505.1 | DNA-binding transcriptional regulator SutR | - |
| LQ200_RS03035 (601815) | 601815..603776 | + | 1962 | WP_001445698.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| LQ200_RS03040 (603868) | 603868..604098 | - | 231 | WP_000491976.1 | YncJ family protein | - |
| LQ200_RS03045 (604320) | 604320..604496 | + | 177 | WP_000813797.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| LQ200_RS03050 (604542) | 604542..604958 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| LQ200_RS03055 (605037) | 605037..606443 | + | 1407 | WP_000760596.1 | PLP-dependent aminotransferase family protein | - |
| LQ200_RS03060 (606688) | 606688..607833 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| LQ200_RS03065 (607851) | 607851..608864 | + | 1014 | WP_000220398.1 | ABC transporter ATP-binding protein | - |
| LQ200_RS03070 (608865) | 608865..609806 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.76 Da Isoelectric Point: 11.5666
>T296541 WP_000813797.1 NZ_OX030728:604320-604496 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT296541 WP_001270286.1 NZ_OX030728:604542-604958 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|