296534

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 84005..84606 Replicon plasmid P2
Accession NZ_OX030703
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag LQ128_RS25845 Protein ID WP_001216034.1
Coordinates 84226..84606 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag LQ128_RS25840 Protein ID WP_001190712.1
Coordinates 84005..84226 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ128_RS25820 (AI2951V1_4957) 79770..80663 + 894 WP_001553853.1 S-4TM family putative pore-forming effector -
LQ128_RS25830 (AI2951V1_4960) 81592..82269 - 678 Protein_98 restriction endonuclease subunit S -
LQ128_RS25835 (AI2951V1_4961) 82266..83822 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
LQ128_RS25840 (AI2951V1_4962) 84005..84226 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LQ128_RS25845 (AI2951V1_4963) 84226..84606 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
LQ128_RS25850 (AI2951V1_4964) 84611..84790 + 180 WP_001513661.1 hypothetical protein -
LQ128_RS25855 (AI2951V1_4965) 84818..85096 + 279 Protein_103 pdcB -
LQ128_RS25860 (AI2951V1_REPA000000249) 85101..85514 + 414 Protein_104 integrase core domain-containing protein -
LQ128_RS25865 (AI2951V1_4967) 85464..85799 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
LQ128_RS25870 (AI2951V1_REPA000000245) 86009..86086 - 78 Protein_106 hypothetical protein -
LQ128_RS25880 86947..87105 + 159 WP_228955855.1 abortive infection family protein -
LQ128_RS25885 (AI2951V1_4971) 87264..88235 - 972 Protein_109 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) senB 1..88990 88990
- inside IScluster/Tn - - 80800..86799 5999


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T296534 WP_001216034.1 NZ_OX030703:84226-84606 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT296534 WP_001190712.1 NZ_OX030703:84005-84226 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References