Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 84005..84606 | Replicon | plasmid P2 |
| Accession | NZ_OX030703 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | LQ128_RS25845 | Protein ID | WP_001216034.1 |
| Coordinates | 84226..84606 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | LQ128_RS25840 | Protein ID | WP_001190712.1 |
| Coordinates | 84005..84226 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ128_RS25820 (AI2951V1_4957) | 79770..80663 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
| LQ128_RS25830 (AI2951V1_4960) | 81592..82269 | - | 678 | Protein_98 | restriction endonuclease subunit S | - |
| LQ128_RS25835 (AI2951V1_4961) | 82266..83822 | - | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
| LQ128_RS25840 (AI2951V1_4962) | 84005..84226 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| LQ128_RS25845 (AI2951V1_4963) | 84226..84606 | + | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| LQ128_RS25850 (AI2951V1_4964) | 84611..84790 | + | 180 | WP_001513661.1 | hypothetical protein | - |
| LQ128_RS25855 (AI2951V1_4965) | 84818..85096 | + | 279 | Protein_103 | pdcB | - |
| LQ128_RS25860 (AI2951V1_REPA000000249) | 85101..85514 | + | 414 | Protein_104 | integrase core domain-containing protein | - |
| LQ128_RS25865 (AI2951V1_4967) | 85464..85799 | - | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
| LQ128_RS25870 (AI2951V1_REPA000000245) | 86009..86086 | - | 78 | Protein_106 | hypothetical protein | - |
| LQ128_RS25880 | 86947..87105 | + | 159 | WP_228955855.1 | abortive infection family protein | - |
| LQ128_RS25885 (AI2951V1_4971) | 87264..88235 | - | 972 | Protein_109 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) | senB | 1..88990 | 88990 | |
| - | inside | IScluster/Tn | - | - | 80800..86799 | 5999 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T296534 WP_001216034.1 NZ_OX030703:84226-84606 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |