Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 25529..26172 | Replicon | plasmid P1 |
| Accession | NZ_OX030702 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | LQ128_RS24925 | Protein ID | WP_001044768.1 |
| Coordinates | 25529..25945 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | E9XUD3 |
| Locus tag | LQ128_RS24930 | Protein ID | WP_001261279.1 |
| Coordinates | 25942..26172 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ128_RS24905 (21844) | 21844..22875 | + | 1032 | Protein_21 | IS3 family transposase | - |
| LQ128_RS24910 (23429) | 23429..23614 | - | 186 | Protein_22 | transposase domain-containing protein | - |
| LQ128_RS24915 (23684) | 23684..23827 | + | 144 | Protein_23 | transposase | - |
| LQ128_RS24920 (24198) | 24198..24806 | - | 609 | WP_000515889.1 | ProQ/FINO family protein | - |
| LQ128_RS24925 (25529) | 25529..25945 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ128_RS24930 (25942) | 25942..26172 | - | 231 | WP_001261279.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQ128_RS24935 (26777) | 26777..27190 | + | 414 | WP_001581782.1 | hypothetical protein | - |
| LQ128_RS24940 (27192) | 27192..27977 | + | 786 | WP_001581781.1 | site-specific integrase | - |
| LQ128_RS24945 (28561) | 28561..29193 | + | 633 | WP_000312331.1 | ParA family protein | - |
| LQ128_RS24950 (29193) | 29193..29567 | + | 375 | WP_000752652.1 | hypothetical protein | - |
| LQ128_RS24955 (29805) | 29805..30779 | + | 975 | WP_001217836.1 | plasmid segregation protein ParM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B | - | 1..90741 | 90741 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T296530 WP_001044768.1 NZ_OX030702:c25945-25529 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3U0EQM4 |