Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4111862..4112480 | Replicon | chromosome |
Accession | NZ_OX030701 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | LQ128_RS19830 | Protein ID | WP_001291435.1 |
Coordinates | 4111862..4112080 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | LQ128_RS19835 | Protein ID | WP_000344800.1 |
Coordinates | 4112106..4112480 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ128_RS19795 (4107149) | 4107149..4107721 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
LQ128_RS19800 (4107752) | 4107752..4108063 | - | 312 | WP_000409908.1 | MGMT family protein | - |
LQ128_RS19810 (4108442) | 4108442..4108795 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
LQ128_RS19815 (4108837) | 4108837..4110387 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
LQ128_RS19820 (4110551) | 4110551..4111021 | - | 471 | WP_000136192.1 | YlaC family protein | - |
LQ128_RS19825 (4111137) | 4111137..4111688 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
LQ128_RS19830 (4111862) | 4111862..4112080 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
LQ128_RS19835 (4112106) | 4112106..4112480 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
LQ128_RS19840 (4113026) | 4113026..4116175 | - | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
LQ128_RS19845 (4116198) | 4116198..4117391 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T296523 WP_001291435.1 NZ_OX030701:c4112080-4111862 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT296523 WP_000344800.1 NZ_OX030701:c4112480-4112106 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |